Update 3/3/2024: This type of suppositories is used in Philippines to fight cancer: https://patentimages.storage.googleapis.com/22/91/8c/b1c8307e0aca1a/US6720356.pdf
Update 11/13/2023: Even more amazing research on analysis of all different studies by Dr. Bryan Ardis in regard to snake venoms and EDTA, going back as far as 1902(!!!): https://www.bitchute.com/video/5si4tt2C3x4g/
Update 8/30/2023: Upcoming ‘Healing For the Ages’ by Dr. E. Group, Dr. Bryan Ardis and Dr. H. Ealy at https://rumble.com/v3b182s-venom-in-pharma-medications-and-vaccines-in-transhuman-reptilian-agenda.html
Interview with title “Venom in Pharma Medications and Vaccines pushing for a transhuman reptilian agenda.“
Update 9/6/2023: RF Kennedy exposes the FRAUD of clinical Pfizer ‘studies’ on X platform, which immediately erases it, here a lucky copy (~4min talk) at:
do you still think Musk and his new CEO are good???
Protein purification in biochemistry almost never happens without the most potent metal chelator, EDTA, which eliminates contaminating divalent cations, hinders protease activity, and inactivates metal ion-requiring enzymes, inactivates venoms, it can be additionally functionalized with graphene oxide to equally remove heavy metals. EDTA is also used for the SARS-CoV-2 ‘universal Spike’ purification^1.
The amino acid sequence of the toxic, patented Spike protein at: https://www.uniprot.org/uniprotkb/P0DTC2/entry contains the cysteines in its C-terminal section 1235 - 1260, the most intriguing, but also the most conserved “CCMTSCCSCLKGCCSCGSCCKFDEDD“ portion of the official NIH entry of SARS-CoV-2 at https://www.ncbi.nlm.nih.gov/protein/1796318598. All these 10 C-terminal Spike cytosolic cysteine residues (C in single letter code) are rapidly acylated, i.e. linked to fatty acids within the ER and Golgi^2. That massive lipidation controls spike biogenesis and degradation, among other important functions. In the post at
analysis of this section was presented, including high homology of its sections with the by A. Fauci patented HIV related cyclic peptide ‘‘CxxxxC”, 2 cysteines separated by any 4 amino acid residues. The post titled “Where did the iron go*, the dopamine and uridine issue with SARS-CoV-2 toxic Spike protein and the mindless science, leading to more thoughts on 'Died Suddenly'. A link to Bing LIU?“ pointed to the fact, that this unusual cysteine rich section is also homologous with part of the crucial liver‐derived anti-microbial peptide hormone, a regulator of systemic iron homeostasis, called ‘hepcidin’, defensin-like peptide, with part of its sequence ‘DTHFPICIFCCGCCHRSKCGMCCKT’. The late Bing Liu pointed out that lipid peroxidation has been recognized as a fundamental part of ferroptosis. The very same name of hepcidin is listed in Table 1 of the article ^3 describing venom peptides, in which hepcidin is described as an ‘antimicrobial cytotoxic peptide’ in animals but not mentioning at all the connection to a human liver hormone, strangely. Questioning of the official documents is always necessary, in particular wiki with its anonymously written entries being cited these days in almost every PhD thesis work, all apparently orchestrated by whom? Intelligence agencies! Here the source https://www.rt.com/news/580735-cia-fbi-edits-wikipedia/ ) For example, in its entry about https://en.wikipedia.org/wiki/Neurotoxin wi-ki defines dopamine as ‘Endogenous neurotoxin source’ (Table 1). That wiki table on the other hand contains also important sources of neurotoxins, bacterial proteins, venoms, metals (Al, Hg, Pb, As) and some organic molecules. The Forgotten Side of Medicine’s recent post ‘How Did We Know That the COVID-19 Vaccines Would Decimate Global Fertility?‘ mentions a frequent anti-phospholipid syndrome suddenly appearing after the covid injections, which deliver exactly that universal Spike, now so much attracted to the phospholipid containing membranes, via exactly the mentioned C-terminal cysteines. This apparently autoimmune condition related to ingredients of every single cell in human body manifests itself ‘only’ in thrombosis or pregnancy losses, in hypercoagulation (according to https://dermnetnz.org/topics/antiphospholipid-syndrome). The complement system is involved in this, that’s the systemic ‘director’ of the innate immunity. When human body is exposed to certain venoms^4, components of the same complement system are literally being eaten up. It is as if the venoms give zero time for the prey to develop any immunity. According to ^4, that ‘conversion’ of the victim to the prey via literal digestion which uses metalloproteases can be stopped by EDTA, which inhibits the digestive enzymes. Metalloproteases in venoms need metals in order to do that chop-chop job, and that is extremely well controlled via metal sensors, transporters and stores, in all living organisms, with some ‘variations’ in snakes, which do not digest themselves of course. The level of the no 1 ‘blood metal’, iron, regulated by the liver peptide hormone hepcidine, involves direct iron sensitivity of mRNA. The hepcidin connection to conotoxins^3, sequences of which are listed in a table from a nature article^5, with few examples of their alignment to the Spike cysteine rich section shown below, only indicate, that many of the very small but powerful Spike fragments which are homolog to pieces of the neuronal-specific a-conotoxins, binding to a7 nAChRs receptors, could be also affected by nicotine, which is the ligand (it binds them) for those receptors. It is funny, but only now I found a study: “Editorial: Nicotine and SARS-CoV-2: COVID-19 may be a disease of the nicotinic cholinergic system“ by a greek team from 2020(!!!) in Toxicology Reports Volume 7, 2020, Pages 658-663, available at: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7192087/pdf/main.pdf
The nicotine remedy for ‘Spike envenomation’ as suggested by Dr. Bryan Ardis does actually work for many people struggling with taste/smell loss, including many other ‘long covid’ symptoms. What Dr. Ardis reveals just recently (8/19/23) is extremely important (it shows a clear proof of cause while experimenting with his own treatment protocolls), that what we’ve being attacked with, is a venom.., here his interview: https://www.brighteon.com/85421178-acb8-4b50-b137-3177b4538f75 which includes the REMEDIES for a total healing.
The by Fauci patented anti-HIV cyclic peptide ‘CxxxxC’ is actually a part of the conotoxins defined as quote: “The α-conotoxins are classified based on their cysteine pattern CC-C-C, with a disulfide connectivity of Cys1-Cys3 and Cys2-Cys4.“ There is a specific family of those called CIA (!!!) and CIB with the pattern CCx3Cx5C and CCx4Cx7C,
both acting on a neuronal and muscle acetylcholine receptors nAChRs depending on acetylcholine neurotransmission. As innocent as they look, these little peptides with the CIA amino acid pattern ‘NGRCCHPACGKHFSC‘ and CIB ‘GCCSNPVCHLEHSNLC‘, function the following way:
“Intramuscular injection of α-conotoxin CIA produces a rapid flaccid paralysis of skeletal muscles, as evidenced by a loss of equilibrium of the fish, and ultimately a complete immobilization.“ Below is shown the BLAST (NIH automated alignment software) and by hand performed alignment of two human defensins, hepcidins and other venom toxins, including the CIA and CIB with Spike, at the very end. The first 3 lines show raw amino acid sequence from Beta-defensin 1 and defensin alpha 4 (the 2 lines), both with antimicrobial properties, some overlapping cellular locations, with different functions though but all related to innate immunity. The NIH BLAST software can’t find any common features between defensins 1 and 2, and yet one can clearly see it below, that these 2 proteins stem from one family. The line 3 represents the full length of hepcidin (also called LEAP-1) discovered by the purification of beta-defensin 1 from human urine.
MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK ->1
MRIIALLAAILLVALQVRAGPLQARGDEAPGQEQRGPEDQDISISFAWDKSSALQVSGSTRGMVCSCR ->2
LVFCRRTELRVGNCLIGGVSFTYCCTRVD ->2
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIF ->3
CCGCCHRSKCGMCCKT ->3 (hepcidin or LEAP-1)
MWHLKLCAVLMIFLLLLGQIDGSPIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRC
SLSVAQE -> LEAP-2, another liver antimicrobial peptide described in
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2312392/pdf/0120143.pdf
DTHFPIC-IFCC----GCCHR-SKCGMCCKT HEPCIDIN 60-84 (1M4F pdb)
T C + CC GCC S CG CCK <<IDENTITIES
VTIMLCCMTSCCSCLKGCC---S-CGSCCKF SARS-CoV-2 Spike
here a SPECIES comparison between HEPCIDIN from human and phyton:
35.0 bits(79) 0.031 Compositional matrix adjust. 21/75(28%) 33/75(44%) 1/75(1%)
Query 11 CLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMF-QRRRRRDTHFPICIFC
C+L +LL A+ + F Q + D + + + RR+R+ +HF +C +C
Sbjct 7 CMLFILLSAATRNLCAFSIQRDVQKDSASLDTYKTETTGLQAWLSRRKRHVSHFALCRYC
Query 70 CGCCHRSKCGMCCKT 84 <= Human Hepcidin
CC G CC T
Sbjct 67 WDCCGNKGYGYCCLT 81 <= Phyton hepcidin-like
a BLAST match between the entire length of HUMAN preproprotein hepcidin (NP_066998.1) and SARS-CoV-2 cystein-rich section of Spike:
26.9 bits(56) 6e-04 11/19(58%) 11/19(57%)
Query 69 CC----GCCHRSKCGMCCK 83 human HEPCIDIN (hH)
CC GCC S CG CCK IDENTITIES
Sbjct 1240 CCSCLKGCC--S-CGSCCK 1255 covid19 Spike
and now by hand a larger fragment of those two:
RAGARASWMPMF---QRRRRRDTHFPIC--IFCC-------GCCHRSKCGMCCK hH
+ + W + F T +C CC GCC S CG CCK Identit.
KWP-WYIWLG-FIAGLIAIVMVT-IMLCCMTSCCSCLK---GCC--S-CGSCCK Spike
few more conotoxins comparisons with Spike:
GCCSHPA--CSVNHPELC α-CTx PeIA toxin
CCMTSCCSCLKGCCSCGS--CCKF Spike
GCCSDPRCNYDHPEI-C α-CTx Vc1.1 toxin
CCMTSCCSCLKGCCSCGSCCKF Spike
ACCSDRRC---RWRC α-CTx ImII toxin
CCMTSCCSCLKGCCSCGSCCKF SPike
IMLCCMTSCC--SCLKGCCSCGSCCKF Spike
CC +C K SC IDENTITIES
NGRCCHPACGKHF-SC CIA conotoxin active peptide
*<=amidation on this cystine
CCX3CX5C and CCX4CX7C = CIA and CIB pattern
IMLCCMTSCCSCLKGCCSCGS-CCKF Spike
CCS C S C IDENTITIES
GCCSNPV-CHLEHSNLC CIB
CIFCCGCCHRSK-CGM----CCKT human Hepcidine (hH)
CIFCCG-CCHRSKCGM--CCKT human Hepcidine (hH)
G CCH + CG C IDENTITIES
NGRCCHPA-CGKHFSC CIA
the human hepcidine looks more like CIA toxin..
The NIH entry for the CIA toxin in its full length can be found at: https://www.ncbi.nlm.nih.gov/protein/D4HPD6.1 and its description contains keywords like ‘Acetylcholine receptor inhibiting toxin; Ion channel impairing toxin; Neurotoxin; Postsynaptic neurotoxin;‘ It is astonishing, that the universally injected Spike, has so much in common in its C-terminal section with the human essential liver enzyme hH (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7563913/ ) related to inflammation and iron regulation, related to the defensins-like families, that publications like https://pubmed.ncbi.nlm.nih.gov/34206990/ or https://pubmed.ncbi.nlm.nih.gov/33017910/ mention, that the ANTI-MICROBIAL innate immune factors, defensins, are the primary defense against covid19, and despite of all this, the building blocks for the very similar HUMAN defensins homologous sections are now used to produce trillions of toxic NON-HUMAN Spikes in the bodies of the covid jabbed.
Defensins homologs in snake kingdom were named disintegrins, which are described little bit in the old post:
The conotoxin name CIA (not explained where it comes from) for part of which Fauci got his patent US 9,896,509 B2 for “USE OF ANTAGONISTS OF THE INTERACTION BETWEEN HIV GP120 AND a4b7 INTEGRIN“, against HIV, could be taken literally, given how much HUMAN suffering one person can cause… And all can be found in NIH data bases, literally written in our faces! It is like with the NIST officials, who told us that the burning gasoline melted all the steel of 9/11 towers which pulverized in the air, and yet we all drive cars for decades with burning gasoline inside of the engine and yet seldom anyone is causing fires with that, unless you drive Tesla, well, not the real Tesla from ~1930, but the X one, you know..! You will say, well there is cooling, BUT that cooling can never touch the surface between gasoline and engine surface!
Anyway, elevated hepcidin levels are associated with Epstein-Barr Virus Infection (Int J Mol Sci 24 (2), 1630 (2023)), it is also associated with poor prognosis of Patients with Clear Cell Renal Cell Carcinoma (Cancer Invest 41 (1), 84-92 (2023)) and it became a diagnostic tool for covid19 patients (Wiad Lek 76 (1), 65-70 (2023)). Search for PATENTED proteins of snake origin similar to the C-terminal portion of covid19 Spike results in a indian cobra protein (NIH entry CAI46845.1) from patent WO 2005003159-A1 13-JAN-2005, which in its entirety (99% sequence coverage) is ~36% IDENTICAL with Spike amino acid sequence across all its domains, implying a basis for a common drug design. This protein is called Cobra Venom Factor (CVF) consists of multiple domains described at https://www.ncbi.nlm.nih.gov/protein/CAI46845.1 and here some of the BLAST (NIH sites) aligned fragments:
21.9 bits(45) 0.51 Compositional matrix adjust. 14/46(30%) 22/46(47%) 6/46(13%)
Query 681 PRRARSVASQSIIAYTMSLGAEN--SVAYSNNSIA----IPTNFTI 720 Spike
PR ++ S + IAY G+ N VA ++ I +P NF +
Sbjct 421 PRERQATKSMTAIAYQTQGGSGNYLHVAITSTEIKPGDNLPVNFNV 466 CVF
Query 439 NNLDSKVGGNYNYLYRLFRK 458. Spike
N+LDS + NYL + + K
Sbjct 1146 NSLDSSIKKATNYLLKKYEK 1165 CVF
Query 446 GGNYNYLYRLFRKSNLKP 463 Spike
GG+ NYL+ + +KP
Sbjct 439 GGSGNYLHVAITSTEIKP 456 CVF
Query 1236 CMTSCCSCLKGCCS 1249 SPIKE
C+ + C C CS
Sbjct 1485 CIGNVCRCAGETCS 1498 CVF
Query 891 GAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSST 941
GAA++I R + V + V N K +Q KI D++ +
Sbjct 560 GAAMKIKLEGDPGARVGLVAVDKAVYVLNDKYKISQ-----AKIWDTIEKS 605
Query 1100 THWFVTQRNFYE 1111
TH +++QR E
Sbjct 1560 THQYISQRKCQE 1571
Query 1252 SCCKFDEDDSEPVLKGVK 1269
CC++ +KGV+
Sbjct 710 ECCRY--------IKGVR 719
ACE2 binding portion
Query 452 LYRLFR-KSNLKPFERDISTEIYQAGSTP------CNGVEGFNCYFP-------------
LYR+F N + + E TP N V+ N ++P
Sbjct 144 LYRVFSMDHNTSKMNKTVIVEF----QTPEGILVSSNSVD-LNFFWPYNLPDLVSLGTWR
Query 492 -LQSYGFQPTNGVGYQPYRVVVL-SFELLHAPA 522
+ Y P N Y R VL SFE+ P+
Sbjct 199 IVAKYEHSPENYTAYFDVRKYVLPSFEVRLQPS 231
Query 199 GYFKIYSK--HTPINL-----VRD--LPQGFSALEP 225
G ++I +K H+P N VR LP L+P
Sbjct 195 GTWRIVAKYEHSPENYTAYFDVRKYVLPSFEVRLQP 230
Query 66 HAIHVSGTN-------GTKRFD 80
H ++ GT+ K+FD
Sbjct 1207 HTHNIEGTSYALLALLKMKKFD 1228
uery 425 LPDDFTGCVIAWNSNNLDSKVGGNYNYL 452
LP +F + N+N+L K + YL
Sbjct 460 LPVNFN---VKGNANSL--KQIKYFTYL 482
CCMTS------CCSCLKGC------CSCGS----CCKF------DED--DSE Spike
CCEDVMHENPMGYTCEKRAKYIQEGDACKAAFLECCRYIKGVR-DENQRESELF ANATO domain VCF
with BLAST getting only one fragment on this cysteine rich section:
Query 1253 CCKFDEDDSEPVLKGVK 1269
CC++ +KGV+
Sbjct 51 CCRY--------IKGVR 59
The last example in the above table compares the Spike with the ANATO domain of the VCF spanning the residues 661..731, including the 666th residue.., and which represents the Anaphylatoxin homologous domain; C3a, C4a and C5a. Anaphylatoxins are protein fragments generated enzymatically in serum during activation of complement molecules C3, C4, and C5, which induce smooth muscle contraction. There is nowhere any entry for a hepcidin-like protein in naja naja species, which do have a liver though.. An example of search in venoms literature (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4889763/) based on just visual inspection of the very short toxic sequences in that paper pointed to yet another protein P25668.1 (uniprot code) discovered in 1971, named ‘long neurotoxin’, in fact very short (71aa), which quote: ‘Binds with high affinity to muscular (alpha-1/CHRNA1) and neuronal (alpha-7/CHRNA7) nicotinic acetylcholine receptor (nAChR) and inhibits acetylcholine from binding to the receptor, thereby impairing neuromuscular and neuronal transmission.’ Here its alignment with few pieces of the SARS-CoV-2 Spike:
Query 28 GFCSIRGKRVDLGCAATCPTVRTGVDIQCCSTDDCDPF 65 neurotoxin (1)
G +I + L C ++C + G CCS C F
Sbjct 1223 GLIAIVMVTIMLCCMTSCCSCLKG----CCSCGSCCKF 1256 Spike (2)
Query 19 VCYTKTWCDGFCSIRGKRV 37 neurotoxin
+C+T + D F IRG V
Sbjct 390 LCFTNVYADSFV-IRGDEV 407 Spike 'RGD' motif
Query 33 RGKRVD 38
KRVD
Sbjct 1036 QSKRVD 1041
The entire c-term of the Spike can be actually overlapped over almost 75% of the entire 1971 toxin, by hand, since BLAST won't do it:
HVCYTKT-WCD--GFCSIRGKRVDLG----CAATCPT-VRTGVDIQCCS------TDDCDPFP-TRK-RP
Y+K W GF + V + C ++C + ++ CCS D+ D P + +
YEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKG-----CCSCGSCCKFDEDDSEPVLKGVKLHY
If by now, you are still not convinced that the CYSTEINE-pattern in the Spike toxin is special, it’s all coincidence, please go to the complete genome of the Mycobacterium leprae, strain MRHRU-235-G chromosome genome, with ~3.2 millions of base pairs, at: https://www.ncbi.nlm.nih.gov/nuccore/CP029543.1 and do a search for ‘CC’ while searching in the amino acid sequence lines starting with the string ‘/translation=’. Among thousands of entries, you will not find a one which has three of the Cys-Cys dipeptides, not to even speak about 4, like in the universally injected Spike toxin. Or search the Borreliella burgdorferi strain B-17/2013 chromosome, complete genome you will not find a single protein in the entire bacterium (1mln base pairs!!) which has 4 Cyc-Cys dipeptides in a short string like the Spike with ~4000 base pairs = 0.004-th of a milion….
G-CCSDPRCNYDHPEICX Pdb Data bank entry 2H8S=alpha-conotoxin Vc1.1
G CC P C H C IDENTITIES
NGRCCH-PACG-KHFS-C CIA conotoxin
If you go to: https://www.rcsb.org/structure/2H8S and just read the abstract of the publication related to that above entry, you will realize, how much effort goes into finding out the importance of every single amino acid residue in order to make something good out of something really bad, or the opposite, something lethal out of something good. Some call it gain/loss of function, depending on what the SCIENTISTS’ INTENTIONS ARE.
Among the plant antidotes against naja-naja venoms (listed in that article at https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4889763/pdf/tropmed-94-1392.pdf ) are Siris Tree, onions, marshmallow, black mustard, lemon, cumin and many more^6.
The most recent interview with Dr. Bryan Ardis at:
https://rumble.com/v321i70-keys-2-life-ep53-dr.-bryan-ardis-watch-the-water-2.html
pointed to antidotes for the Spike and its fragments (venoms in his opinion): Glutathione, NAC, Vit C, and EDTA.
Recent very loud news everywhere about EDTA and VitC clearing the blood of the covid injected AND apparently equally NON-injected people(?), talk not about proteins or even the artificial toxic Spike, but rather about taking apart hydrogels, and graphene by partly exactly the same remedies, EDTA and VitC….. Looks like part of the remedies match both interpretations of the covid story. NIST handbook about graphene applications mentions H2O2, which degrades the 1 atom-thick hexagonal carbon lattice, i.e graphene.
Lets touch the EDTA, which chelates equally well aluminum^7. FDA approved EDTA for chelation of heavy metals in 1948 used first in lead poisoning of certain workers (https://www.harborcompounding.com/edta-and-heavy-metal-toxicity). Today it is being applied in IV or suppositories form. EDTA also dissolves hydrogels^8, which are for example part of Mod-E-RNA covid injection materials^9. It can be bound to functionalized magnetized graphene oxide for removal of mercury, lead and copper^10.
In the past NIH did perform EDTA chelation therapies, which concluded, quote: ”Post-myocardial infarction patients with diabetes mellitus aged ≥50 demonstrated a marked reduction in cardiovascular events with EDTA chelation.”^11, ^12. One of the presenters in oral health docu series (NaturalHealth365Programs.com), Dr. Thomas Yanossy^13, known for his ORADIX EDTA and glutathione containing suppositories (used for chelation on his own father with Alzheimers), mentioned, that it was Monsanto who carries the 1935 EDTA patent and that the research leading to its discovery was connected with looking for a ‘replacement’ of the well known citric acid chelator. Monsanto did very few, if any good things, so one needs to ask, why to replace the citric acid from the ‘Citric acid cycle’ also known as Szent-Györgyi-Krebs cycle or TCA or Krebs cycle, which is the A and O of cell metabolism in all species, the delivery of the ENERGY via RESPIRATION through the oxidation of acetyl-CoA derived from carbohydrates, fats, and proteins, the entire food?
If one thinks to get to basics, time will flow, because Szent-Györgyi got his 1937 Nobel prize for " his discoveries in connection with the biological combustion processes, with special reference to vitamin C and the catalysis of fumaric acid" (https://www.nobelprize.org/prizes/medicine/1937/summary/) and Hans A. Krebs received his for “discovery of the citric acid cycle” (apparently the same cycle from 1937) in 1952 (https://www.nobelprize.org/uploads/2018/06/krebs-lecture.pdf) and didn’t mentioned in a single word the Vitamin C… Thus in 1952 the vitamin C disappeared from the tricarboxylic acid cycle (TCA)… There are other important things which happened in those years, all related to Monsanto’s glyphosate (N-phosphnomethylGLYCINE), but that might come later. Here just one thing, EDTA was developed by a german chemist working for IG Farben in early 1930-ies on a ‘replacement’ for a citric acid.
What’s the difference between citric acid and ascorbic acid, i.e. Vitamin C?? https://www.quirkyscience.com/citric-and-ascorbic-acid/
The highest concentration of vitamin C is in human adrenal glands^9, that’s where Szent-Gyorgyi was looking for it first, later on, he found its source in peppers, and once his work on this topic was done, within 2 years, the chemical industry got its synthetic version C6H8O6, versus what Krebs found 15 years later, C6H8O7. Both Szent-Gyorgi and Krebs enjoyed Rockefellers’ support in their research, which now lead to that difference of one atom of oxygen, that’s huge, optical properties are very different, in UV range in particular. Krebs work cites a malonate which is inhibiting the respiration of all animal tissues, and also mentions that injection of fluoroacetate into the intact organism leads to an accumulation of citrate in animal tissues and represents yet another valuable specific inhibitor of respiration.. A quote from his 1952 lecture about the injection experiment: “fluoroacetate and oxaloacetate appears to prevent competitively the metabolic removal of citrate. “ “The accumulation of citrate in the poisoned organism, by analogy with the accumulation of succinate, may be taken as an indication of its normal intermediary formation.“ in the TCA cycle…
This will be a very stup.. question, to any chemist who might read this.
The Spike, the acute respiratory syndrome coronavirus 2 (with no 3D structure in any NIH data base) is all about respiration, and yet what brings people back in emergency are VITAMIN C IV injections, in huge amounts, never anything happens when doing it, no deaths, no pain. And yet anyone heard about citric acid IV’s, with one more oxygen in every molecule…? On the contrary, one can read the following titles “Citric Acid in Drug Formulations Causes Pain by Potentiating Acid-Sensing Ion Channel 1“ (https://pubmed.ncbi.nlm.nih.gov/33888605/) or from an abstract “The fastest combination was the injection of 150 g·L−1 citric acid solution in four injection sites (5 mL per site), which killed the starfish in 26.4 ± 4 h.“ (https://www.researchgate.net/publication/311635861_Citric_Acid_Injections_An_Accessible_and_Efficient_Method_for_Controlling_Outbreaks_of_the_Crown-of-Thorns_Starfish_Acanthaster_cf_solaris). Well clearly citric acid is a great metallic ion chelator in antioxidant systems, and not only that, “Citrate is an endogenous inhibitor of snake venom enzymes by metal-ion chelation” (https://pubmed.ncbi.nlm.nih.gov/1440629/) and also, while belonging to the s.c. Alpha Hydroxy Acids (AHA, moment…) it removes the top layers of dead skin cells.. When the gene in mice for the Vitamin C transporter protein (SVCT2) is deleted, the animal suffers cerebral hemorrhage and death. Ascorbate protects neurons from oxidative damage, essential in Alzheimer’s, Parkinson’s, and Huntington’s. Dr. Thomas A. Levy has a great resource of what Vitamin C can do in all health situations, it can be found at: http://www.doctoryourself.com/Levy%20Vitamin%20C%20Therapy%20Manila%202017.pdf
or also at: https://www.peakenergy.com/video.php
Szent-Gyorgyi was deriving his detailed conclusions while working with natural tissues and discovering ascorbic acid, and yet Dr. Krebs (in german it means Cancer) discovered different acid, aligning with the newest science confirming, that the human gene for production of ascorbic acid is lost. BUT somehow all the receptors binding the VitC are still there??? Why VitC participates in so many processes, it is essential for the CNS system, so many proteins have it as co-factor yet the gene for its production is gone (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3145266/), but apparently it is still present in newborns ( https://www.sciencedirect.com/science/article/abs/pii/S0006291X9991272X ) and maybe gone after aluminum exposure, just a huge speculation. Dr. Levy attributes it to EPI-genetic changes saying, the gene is there but its translation in cytosol in the process of mRNA-ribosome interaction is impaired... Ironically among the few vertebrates missing the last gene in the ascorbic acid formation from glucose are guinea pigs, and fruit bats! (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3725125/). That silenced/lost gene in question, encodes the enzyme L-gulono-1,4-lactone oxidase (EC 1.1.3.8) and the reaction that enzyme performs is the following:
L-gulono-1,4-lactone + O2 = H+ + H2O2 + L-ascorbate
The official ‘explanation’ for the loss: “Sequence analysis study indicated that the human L-gulono-gamma-lactone oxidase gene has accumulated a large number of mutations since it stopped being active and that it now exists as a pseudogene in the human genome.“ (Am J Clin Nutr 1991 Dec;54(6 Suppl):1203S-1208S. doi: 10.1093/ajcn/54.6.1203s.). So why only in humans and guinea pigs, or maybe in human guinea pigs(…), like the evolution from apes with few leftover apes out there until this very day??? Here yet another scientific explanation, from 1966 in journal ‘OXIDATION-REDUCTION AND BIOENERGETICS’ in a study titled “A Kinetic Study of the Mechanism of Action of l-Gulonolactone Oxidase.” (https://www.sciencedirect.com/science/article/pii/S0021925818965506, quote:
“in the presence of oxygen and 2,6-dichloroindophenol (DCI) the enzyme decreased in activity as the oxygen pressure rose above 4 atm. This is consistent with there being two specific binding sites in close proximity to each other; each site binds only one of the two oxidants, oxygen or DCI, and inhibition occurs when both sites are occupied.“
At least that study showed, that a chemical can inhibit the enzyme, BUT, at 4 atm??? Looks like in the 60ies that Gulonolactone Oxidase enzyme topic was very hot, despite of no global warming at that time…. In 1965, a new study at https://www.jbc.org/article/S0021-9258(18)96626-3/pdf
was published, with the title: “Studies on Microsomal Phospholipids That Inhibit Gulonolactone Oxidase*” announcing, quote: “Complete inhibition of oxidation of L-gulono-y-lactone to ascorbic acid by liver microsomes was observed in tocopherol-deficient rats and rabbits (1, 2). The inhibition is completely prevented or immediately reversed by the addition of tocopherol, Mn++, Co++ cations or ethylenediaminetetraacetate (EDTA) to the enzyme system (3).
So EDTA can completely reverse the by phospholipis caused inhibition of L-GLO! ??
So how the by the scientists estimated 40 million(???) years long history of dissapearing VitC essential enzyme can be fixed? NIH offers the solution at: https://pubmed.ncbi.nlm.nih.gov/14962674/ in an article titled “Functional rescue of vitamin C synthesis deficiency in human cells using adenoviral-based expression of murine l-gulono-gamma-lactone oxidase“ with the quote:
“The cloning of the murine Gulo cDNA and the construction of Gulo-expressing adenoviral vectors are vital steps toward determining the role of vitamin C in basic metabolism and in disease.“
Vitamin C rescue with viruses??? Wait a moment, didn’t Szent-Gyorgi show enough? Do certain genetic mutations happening only to humans and guinea pigs, while everybody else was thriving and happy, full of ascorbig(←intention) acid, make any sense to anyone?
And there is more fishy stuff when looking into Monsanto’s ‘citric acid issues’ related to the first EDTA patent. Their patent for “Sorghum aluminum tolerance gene, SbMATE” (US7582809B2, https://patents.google.com/patent/US7582809B2/en ), describes a major aluminum tolerance SbMATE gene, which encodes a root citrate efflux transporter that is Al(ALUMINUM)-inducible at the level of gene transcription and is also Al-activated at the level of protein function. In order for the plant to survive the aluminum onslaught, the Monsanto specialists decided to produce more of the ENERGY=>TCA cycle=>citric acid related genes in their new hybrids.
And all of it must be somehow connected, since how can we have vaccines, for ages, ‘contaminated’ (all well known, approved and mandated by the gov) with the very same metal, out of so many others in the periodic table? The same metal is being sprayed in the skies( https://www.geoengineeringwatch.org/), it is in our water and food supply. We are loosing the MEMORY, partly because of it.
One good thing left by Mon-san-to: EDTA and citric acid, with the latter now used in leprosy.. More info on it can be found in an article “Effects of Citric Acid on the Healing Process of Chronic Wound due to Leprosy“, published ‘just on time’ in Int J Low Extrem Wounds. 2023 Jan 5;15347346221147398.
To add to this topic, covid19 issue is not free from citric acid issues either, since it is all energy, according to the late Dr. Cancer (Krebs in german) here an example:
https://www.nature.com/articles/s41467-021-22166-4#MOESM1
“SARS-CoV-2 infection rewires host cell metabolism and is potentially susceptible to mTORC1 inhibition“.
This post is NOT finished, it is still having lot of issues and many questions, but it became so long that it needs to be ended here, at this late hour.
Thank you for your patience, in case you got that far here;)) Just realized, part of the post shouldn’t even be here. SORRY!
Dr. David Martin with his general critics^16 of the entire modern science, will and should shock every scientist involved in the topic of genetic modifications of our nature/humanity. According to the ex-KGB agent, Y. Bezmenov, only then, you will wake up and STOP DOING SUCH SCIENCE. That shock is not the electrical one, but rather mental.
Let’s close with a short list of more useful EDTA resources and applications:
https://www.detoxamin.com/references/
https://www.blushield-us.com/products/remedylink-medicardium-edta-chelation-suppositories. ( a seldon Mg-di-potassium EDTA salt, looks to me like the best one…)
https://edta.net/detoxamin-prostate-studies/
https://eartheracademy.com/course/edta-enema-for-heavy-metal-detoxification/
Literature.
Jeffrey M. Schaub et al. “Expression and characterization of SARS-CoV-2 spike proteins“ Nature Protocols volume 16, pages 5339–5356 (2021), https://www.nature.com/articles/s41596-021-00623-0
Francisco S Mesquita et al. “S-acylation controls SARS-CoV-2 membrane lipid organization and enhances infectivity“ Dev Cell. 2021 Oct 25;56(20):2790-2807.e8.
doi: 10.1016/j.devcel.2021.09.016. Epub 2021 Oct 1. https://pubmed.ncbi.nlm.nih.gov/34599882/
Vidya V et al. “Venom peptides – A comprehensive translational perspective in pain management“ Curr Res Toxicol. 2021; 2: 329–340. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8473576/
G. Eggertsen et al. “In vitro studies on complement inactivation by snake venoms” Toxicon Volume 18, Issue 1, 1980, Pages 87-96. https://www.sciencedirect.com/science/article/abs/pii /0041010180900343
Layla Azam & J Michael McIntosh “Alpha-conotoxins as pharmacological probes of nicotinic acetylcholine receptors“ Acta Pharmacologica Sinica volume 30, pages 771–783 (2009). https://www.nature.com/articles/aps200947/tables/2
https://downloads.hindawi.com/journals/bmri/2014/970540.pdf
A. Fulgenzi et al. “Efficacy of chelation therapy to remove aluminium intoxication“ Journal of Inorganic Biochemistry Volume 152, November 2015, Pages 214-218https://www.sciencedirect.com/science/article/abs/pii/S0162013415300829
Comprehensive Biomaterials 2011 book by Paul Ducheyne, Paul Ducheyne, Kevin Healy, Dietmar W. Hutmacher, David W. Grainger, C. James Kirkpatric.
2018 MODERNA patent US 10,064,959 for “MODIFIED NUCLEOSIDES, NUCLEOTIDES , AND NUCLEIC ACIDS , AND USES THEREOF“ https://assets.modernatx.com/m/6dc651c06fafd781/original/US10064959.pdf
2020 MODENA patent US 10,702,600 for “BETACORONAVIRUS MRNA VACCINE“ https://assets.modernatx.com/m/6fa93a4f95208572/original/US10702600.pdf
L. Ciu et al. “EDTA functionalized magnetic graphene oxide for removal of Pb(II), Hg(II) and Cu(II) in water treatment: Adsorption mechanism and separation property”. Chemical Engineering Journal Volume 281, 1 December 2015, Pages 1-10 https://www.sciencedirect.com/science/article/abs/pii/S1385894715008839
Esteban Escolar et al. “The effect of an EDTA-based chelation regimen on patients with diabetes mellitus and prior myocardial infarction in the Trial to Assess Chelation Therapy (TACT)“ Circ Cardiovasc Qual Outcomes 2014 Jan;7(1):15-24. https://pubmed.ncbi.nlm.nih.gov/24254885/
Clin Chem Lab Med. 2007;45(5):565-76.
doi: 10.1515/CCLM.2007.110. “The role of ethylenediamine tetraacetic acid (EDTA) as in vitro anticoagulant for diagnostic purposes” Giuseppe Banfi et al.
https://oradix.com//ninety-percent-reduction-in-cancer-mortality-after-chelation-therapy-with-EDTA-the-famous-swiss-study
P Patak 1 , H S Willenberg, S R Bornstein “Vitamin C is an important cofactor for both adrenal cortex and adrenal medulla“ Endocr Res. 2004 Nov;30(4):871-5. doi: 10.1081/erc-200044126. https://pubmed.ncbi.nlm.nih.gov/15666839/
B. O’Callahan, O. Qafoku, Waters K. et al., “Atomic force microscopy and infrared nanospectroscopy of COVID-19 spike protein for quantification of adhesion to common surfaces.” Langmuir 37, 12089-12097 (2021). [DOI: 10.1021/acs.langmuir.1c01910] https://www.osti.gov/biblio/1827416
the last video at https://expose-news.com/2023/08/10/there-was-no-sars-cov2-disease-just-a-set-of-symptoms-and-a-branding-campaign-dr-david-martin/
Another BRILLIANT post, mejbcart!
One quick reminder is olive leaf to help restore vitamin C -
https://www.youtube.com/watch?v=35sL8ofwvaY
Great info, Thank you !