Stew Peters' documentary: "Died Suddenly". The issue around the remedies. More questions and Fauci, again.
Everyone can see it, starting today. It is available at:
https://rumble.com/v1wac7i-world-premier-died-suddenly.html
or on the swiss news channel (with lot of real news every day, some in German though…) at:
https://uncutnews.ch/stew-peters-praesentiert-die-weltpremiere-ploetzlich-gestorben/
PLEASE, START WAKING UP EVERYONE AROUND YOU. Send it to your friends, family, peers, your employers, your school directors, your university teachers. Everyone on this planet needs to see these facts, A.S.A.P. and the covid injections insanity needs to be stopped with consequences for those, who are responsible.
THANK YOU.
Since humanity NEVER paid an attention to Codex Alimentarius and allowed ever expanding powers of chemical/pharmaceutical/medical industry, we ended up with ‘Died Suddenly’! Small introduction can be found at
https://www.brighteon.com/daea5da8-33b1-4aa6-aae8-21c58677893e
“Codex Alimentarius” by Dr. Rima Laibow or by another expert, a former oil industry executive, who turned to an activist at: https://www.bitchute.com/video/07qW2TGmsgQ1/
BREAKING NEWS 12/13/2022: “Dr. David Martin - Grand Jury Announcement“ https://www.brighteon.com/2764c92f-8d6d-4fc3-8c30-2cf3a42e84ea
Below is a table with autopsy findings from recently published article titled: ”Autopsy-based histopathological characterization of myocarditis after anti-SARS-CoV-2-vaccination” at https://link.springer.com/content/pdf/10.1007/s00392-022-02129-5.pdf
which looks like didn’t really searched through the vein contents, just the muscles…
After some feedback written by few MD’s in response to ‘Died Suddenly’ documentary, I’d like to add more questions, to the entire problem. It is at the very end of this post. Just wanted to add that building a MASSIVE apparently ‘hydrogel’ from just ONE piece cut out of middle of the millions of Spikes (which btw. can’t even be apparently digested) is highly questionable, to me… Is that image below looking like what the embalmers are pulling out of the bodies in the image above????
The most recent interview of Dr. Cole, indicated by Sally (my frequent commenter, THANK YOU) goes into more details of the clots: https://rumble.com/v1y4u78-foot-long-blood-clots-from-mrna-says-pathologist-dr.-ryan-cole-w-dr-kelly-v.html
Newer Dr. Cole interview with Dr. Drew at: https://www.bitchute.com/video/xwStelZ5uZPC/ specifies more the contents of the rubbers (still not mentioning exactly the technique with which it was determined). Here comes his list:
collagen→ hydroxyPROLINE, Reticulin: collagen related, ELASTIC lammela: G, P, A, Y, DESMOSINE, ISOdesmosine and IDO-desmosine, LYSINE, LEUCINE, Di-TYROSINE. Possibly all byproducts of Elastase, fibrin degradation, building the final amyloid.
I’d like to add one question for Dr. Cole: were these clots there in 2020, before the massive gene modification treatments on the entire humanity started???
Another summary endorsed by S.Kirsch himself was the one written by ‘A Midwestern Doctor’, who is not mentioning in a single sentence the genetic reprogramming of the human body by the covid injections. The entire medical establishment is silent about that part, and that’s criminal, in my opinion.
==================Here some reactions by others to the premiere:
Dr. David Martin: https://banned.video/watch?id=637ed5797cef1858adb5a5f9
Natural News: https://www.naturalnews.com/2022-11-25-died-suddenly-film-is-a-powerful-showcase-of-vaccine-dangers-where-is-dr-jane-ruby.html
SGT (Tod Callender and Dr. Lee Vliet) report: https://www.sgtreport.com/2022/11/died-suddenly-film-review-its-a-powerful-showcase-of-vaccine-dangers-but-why-is-dr-jane-ruby-missing-from-the-film-when-she-broke-the-story-about-fibrous-clots-in-the-first-place-updated/
https://www.bitchute.com/video/AZGx0AuH3ww2/
and now some controversial, first this: https://www.forbes.com/sites/brucelee/2022/11/22/new-died-suddenly-film-pushes-unfounded-depopulation-claims-about-covid-19-vaccine/
and then this, older one: https://www.wcjb.com/2021/09/02/democratic-party-leaders-remember-activist-who-died-suddenly/
or this: https://www.fox29.com/news/west-philadelphia-community-mourns-sudden-loss-of-influential-youth-leader-and-activist
or this recent update on deaths at: https://uncutnews.ch/in-eigener-sache-und-neue-interessante-videos-burgergeld-blackrock-transhumanismus-todesspritze/
the reports are under ‘TEIL LXXII-72’ and ‘TEIL IX-9’.
With one word, what Stew’s documentary showed, is just a tiny, tiny, tiny fraction of reality, which is way, way, way more brutal, and complex.
Tom Renz just wrote great summary too, without speculations, assumptions, plain and simple, the best:
Prof. Suharid Bhakdi gives the most scientifically correct interpretation of what the injections do to human bodies, in my opinion, unfortunately in German at: https://uncutnews.ch/mit-lichtgeschwindigkeit-zur-selbstanklage-das-neuste-interview-mit-prof-bhakdi/
also todays’ short interview with Prof. Bhakdi gives the most important message of all (the second video):
https://uncutnews.ch/bitte-nicht-vergessen-und-neue-interessante-videos-dr-daniele-ganser-beobachtungen-zur-corona-impfung-dr-sucharit-bhakdi-prominente-gegen-impfungen-rainer-rupp-und-mehr/
==================
A reaction of a pathologist Roger Hodkinson to the die off during covid injections insanity: JAIL for all those involved…
https://uncutnews.ch/pathologe-wutend-jeder-arzt-der-daran-beteiligt-war-gehort-ins-gefangnis/
=====================UPDATE ON VAERS records.
Since VAERS recently ERASED EU entries for deaths and injuries after the covid injections, I’ll keep here a records of weekly updates on JUST the deaths after the BIVALENT covid-2 injections. It started with 6 cases for couple of weeks, then jumped to 16, 29, 36, over 40, every following week. This week, it shows the biggest jump in the last few months of introducing this next lethal injection:
11/18/2022: 65 cases
11/25/2022: Found 80 cases where Vaccine is COVID19-2 and Patient Died (1,2,4,6,31,28,8; 11/18/2022 release of VAERS)
12/2/2022: From the 11/25/2022 release of VAERS data: Found 90 cases where Vaccine is COVID19-2 and Patient Died
12/9/2022: From the 12/2/2022 release of VAERS data: Found 92 cases where Vaccine is COVID19-2 and Patient Died (lets hope that new number reflects the fact that few people are getting the military bioweapon genes modifying injections, and NOT DATA MANIPULATION AGAIN..)
12/16/2022: From the 12/9/2022 release of VAERS data: Found 106 cases where Vaccine is COVID19-2 and Patient Died (1,2,2,5,6,40,42,8=106)
12/23/2022: From the 12/16/2022 release of VAERS data: Found 109 cases where Vaccine is COVID19-2 and Patient Died (=> somebody must be heavily erasing some data here…)
12/30/2022: From the 12/23/2022 release of VAERS data: Found 117 cases where Vaccine is COVID19-2 and Patient Died (1,2,2,5,8,43,48,8 =117)
1/6/2023: From the 12/30/2022 release of VAERS data: Found 121 cases where Vaccine is COVID19-2 and Patient Died (1,2,2,5,8,45,49,9=121)
1/13/2023: From the 1/6/2023 release of VAERS data: Found 133 cases where Vaccine is COVID19-2 and Patient Died (1,2,2,6,9,49,49,15=133)
1/20/2023: From the 1/13/2023 release of VAERS data: Found 143 cases where Vaccine is COVID19-2 and Patient Died (1,2,3,6,9,52,55,15=143)
1/27/2023: From the 1/20/2023 release of VAERS data: Found 158 cases where Vaccine is COVID19-2 and Patient Died. (1,3,3,8,11,56,61,15=158)
2/3/2023: From the 1/27/2023 release of VAERS data: Found 166 cases where Vaccine is COVID19-2 and Patient Died. (1,3,3,8,11,60,65,15=166)
2/18/202: From the 2/10/2023 release of VAERS data: Found 184 cases where Vaccine is COVID19-2 and Patient Died. (1,1,3,3,9,12,65,73,17=184)
until now ~10-20 deaths per week, so now after ~ 4 weeks, the death rates stays:
3/24/2023: From the 3/17/2023 release of VAERS data: Found 228 cases where Vaccine is COVID19-2 and Patient Died
5/16/2023: From the 5/5/2023 release of VAERS data: Found 263 cases where Vaccine is COVID19-2 and Patient Died
6/2/2023: From the 5/26/2023 release of VAERS data: Found 278 cases where Vaccine is COVID19-2 and Patient Died (1,2,6,4,16,18,88,116,27=278)
seems like the oldest are dying with the fastest rate!
SHUT DOWN CDC/FDA/NIH NOW!
======= FEEDBACK, remedies and Fauci (2nd part of the main post)======
Viewing of that documentary, brought few more thoughts, about possible remedies fighting off this disaster.
In terms of trying to even remotely understand what might be going on in the human bodies, leading to the ‘white stuff’ accumulating in the blood vessels of the deceased, developing over a period of ~ 5months, according to Steve Kirsch, who is also indicating that’s an ‘amyloid protein’ (at ~48:30), I’d like to go back to the ~0.5 year old post at:
“All the information in a living cell ultimately resides in the precise order of the nucleic acids and amino acids—in DNA, RNA, and proteins.”=> Craig Venter.
All my posts are exactly about these sequences, which Venter mastered to a great level. Here one more quote from his book “Life at the speed of light. From the double helix to the dawn of DIGITAL Life”” with the above quote: “The most common single-gene-hereditary disease in Caucasians—affecting around one in 3,500 births in the United States—is cystic fibrosis, an example of a misfolding, misbehaving protein. It’s caused by a defect in the gene that codes for a protein called cystic fibrosis transmembrane conductance regulator (CFTR). This protein regulates the transport of the chloride ion across the cell membrane; when it’s faulty, a wide range of symptoms results. As one example, the imbalance of salt and water in patients with cystic fibrosis makes their lungs clog up with sticky mucus, which provides a growth matrix for disease-causing bacteria. Lung damage caused by repeated infections is the leading cause of death for people with the disease.“ Further “Degradation of protein aggregates and protein fragments is of vital importance, because they can form build-ups, or plaques, that are highly toxic. When garbage removal halts as a result of a strike, and malodorous detritus piles up on the streets, traffic slows and the risk of disease rises, and a city rapidly becomes dysfunctional. The same is true of cells and organs. Alzheimer’s disease, the tremor of Parkinson’s, and the relentless decline
caused by Creutzfeldt-Jakob disease (the human form of mad cow disease)
all result from the accumulation of toxic, insoluble protein aggregates.“ Aaron Ciechanover, Avram Hershko, and Irwin A. Rose won the Nobel Prize in Chemistry in 2004 for deciphering of this basic mechanism of cellular ‘waste disposal’.
Is CFTR gene connected wit covid?? Here a publication free to read:”CFTR Modulation Reduces SARS-CoV-2 Infection in Human Bronchial Epithelial Cells” (https://pubmed.ncbi.nlm.nih.gov/35456026/) with its conclusion: “Our study provides evidence that CFTR expression/function is involved in the regulation of SARS-CoV-2 replication, thus providing novel insights into the role of CFTR in SARS-CoV-2 infection and the development of therapeutic strategies for COVID-19.“ Another connecting dot here: the transport of the chloride ion across the cell membrane, exactly the process affected by ivermectin, which ”induces chloride-dependent membrane hyperpolarization and cell death in leukemia cells” (In “The antiparasitic agent ivermectin induces chloride-dependent membrane hyperpolarization and cell death in leukemia cells” at https://pubmed.ncbi.nlm.nih.gov/20644115/).
An atomic analysis of the white rubber-like stretchy material (not real blood clots in human veins/arteries) was partly done by Mike Adams and few other groups, like:
investigated the vials contents and the effect of blood addition, but that didn’t include the complete analysis of the intact organic biological compounds of these materials pulled out of human bodies by the embalmers. One needs a complete physico-chemical analysis of these structures, which I’m not sure, was done completely by anyone, so far. Without that, all we can do is to speculate, to some extend. As of 11/30, Dr. Cole presented more extensive analysis of the ‘white rubbers’, which can be found at https://rumble.com/v1y4u78-foot-long-blood-clots-from-mrna-says-pathologist-dr.-ryan-cole-w-dr-kelly-v.html
The most important of all right now, is to find out what can dissolve these rubber bands safely in living human bodies, in order to help the injected victims.
In the above interview, Dr. Cole’s mentions Nattokinase, an enzyme derived from fermentation of soybeans, enzyme with direct fibrinolytic activity.
Lot of MD’s treating the injection injured have good results with ivermectin, for example, with some relief from the symptoms. The reason would be because it binds to the Spike and becasue of that possibly inhibits the aggregation of the growing unfolded pieces left over by the partial enzymatic digestion. Some MD’s suggest intermittent fasting, which is another strategy to limit access of sugars binding to the Spike. Knowing that Spike contains the ‘RGD’ tripeptide responsible for its ‘sticking’ properties:
I’d even give a try this crazy idea, to supplement with aspartic acid (D) and arginine (R) powders in order to neutralize the charge of that tiny dipole by those single amino acids.. Also the EDTA chelation therapy involving the metals and hydrogel (PEGylated nanolipids) removal could be of huge value, something few MD’s are practicing for a long time already, with Dr. Thomas Janossy being the pioneer in developing the most effective Detoxification Suppositories, ever since 2001 (https://oradix.com/author/oradix/)! Dr. Thomas Levy MD, JD is another hero of mine, who is treating the liver remedies with tremendous success using alpha lipoic acid. Right now his new recommendations in regard to dis-eases can be found on his home page at: https://www.peakenergy.com/About-Dr-Levy.php and also this short preview announces his future workshop:
Generally a healthy immune system will recognize foreigners and send out its army of macrophages to catch the invaders, which could include that entire injected nanocomplex. Since their activation is GcMAF dependent, and that can only happen with bound VitD to it, the sufficient amount of VitD is thus essential to that pathway.
The most detrimental part of the covid injections next to the synthetic genetic mod mRNA materials are the nanolipids, described at: https://www.caymanchem.com/news/intro-to-lipid-nanoparticle-formulation#stability
Here just few ideas, based on the known facts about nanolipids. A possible way to dissolve nanolipids are indicated in the following article^6, and involve DMSO and related compounds. Since one of the compounds used to build Pfizer and Mod-E-RNA lipids contain cholesterol, addition of known cholesterol remedies like lecithin or phospatidylcholine could be given a try. Among known products could be Essential Phospholipids (LipoPhosForte from NUtricology or LipoFlowForte from Internat. Research and Development Corp.) or/and Plaquex IV. In an ideal case the large amount of the good lipids could enclose the toxic nanolipids and escort them for a removal, including the genetic material… Early 2021 I came across a publication titled “Physiology and Physical Chemistry of Bile Acids“^14 essential compounds produced by the liver and playing a role in metabolic regulation, antimicrobial functions and solubilization of lipids in digestion. Their importance in liver inflammation in lowering the overall levels of toxins is known for a long time. That article mentioned 2 clinical trials^15.^16 investigating the bile derivatives as anti-SARS-CoV2–2 agents.
The only issue with a large scale lipids destruction in case of the covid injections would be the suddenly released large amount of the synthetic genetic material, which should be taken care of by again some kind of opposite charged aromatic compounds.
The case of already partly build up agglomerates as seen in the Stew’s story, caused by the covid injections, can possibly be helped with some research on Alzheimers and Parkinsons diseases, which deal with plaques buildup, i.e. aggregated proteins prone to accumulation due to not being able to be properly digested. It was found out that an addition of the simple amino acid serine can affect the disease and result in positive outcome^7,^8, ^9, ^10. Serines in proteins frequently bind water molecules, which when added as single amino acids can help to ‘solubilize’ the aggregates. The fundamental chirality conversion of all amino acids (L<→D) in the presence of microwave radiation can possibly play a role in this entire scenario too. A commnter from other platform just pointed to a published research on curcumin and quercetin for disaggregation of prion fibrils. Since both these compounds have large aromatic rings structures, the same mimicry could be expected from other compounds like fulvic and humic acid. This research was posted by Dr. Mihalcea just recently.
With these general SAFE suggestions, not advice, but actually observations based on literature, the applications of simple amino acids, good lipids, aromatic natural compounds, it is time, that people take their own health in their own hands:)
Since the injection vials contain ~0.5ml of chemical compounds, the many times multiplied volume of the white stuff indicates, human body parts are being utilized in order to build up the growing mass. That’s the genetic reprogramming part of the synthetic Spike genome, I do believe. Whoever came up with that 3x1273 long synthetic nucleotide, robbing every victim of 1273 ATP neurotransmitters during every single Spike translation, should have an idea of how to eliminate it from the human body. Let’s hope it was a human…..
To realize that every single new normal human protein, average in size of ~200 amino acids, ~6x smaller then Spike, equally needs ATP for every single residue building up that protein, is extremely important. There is not a single amino acid put in place in our bodies without one ATP molecule (again, a neurotransmitter), one Mg+2 ion and one water, in order to place it properly within the amino acid sequence of the final functional protein. Every amyloid can be controlled by a family of proteins, again ATP dependent, called chaperones, the cells defense army. Here is a list of some of them copied from a publication^1 at https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4646301/
TABLE 1
Proteins with anti-amyloid chaperoning activity
Chaperoning protein Client protein Reference
proSP-C BRICHOS SP-C, Medin, Aβ40, Aβ42 37 and 81
Bri2 BRICHOS Aβ40, Aβ42 37 and 60
Gastrokine-1 BRICHOS Aβ40 36
CsgC CsgA, CsgB, α-synuclein 57
Hsp70 Aβ42, α-synuclein 83 and 84
Hsp90 Aβ42 83
Hsp27 Aβ40 85
DnaJ B6 Aβ42 86
Prefoldin Aβ42 87
αB-crystallin Aβ40, Aβ42 88
Clusterin Aβ42, calcitonin, lysozyme, α-synuclein, β2-microglobulin, κ-casein 89
Haptoglobulin α2-macroglobulin Aβ42, calcitonin, lysozyme 90
Lysozyme Aβ40 91
Pyruvate kinase Aβ40 16
Catalase Aβ40 16
β-Lactoglobulin Aβ40 16
α-Lactalbumin Aβ40 16
Albumin Aβ40 16
=================================================
So if the white new clots are the aggregated parts coming from the suddenly emerged new synthetic Spike, now a HUMAN part, without the original DNA, which normally would have a continuous chain of assigned chaperones assigned to accompany for proper final folding of every protein^2, or proper fix in case of aggregates, would now imply a substantial missing piece of that ‘synthetic biology’ injected into HUMANS. The missing piece of chaperones, working under assistance of the ATP neurotransmitter, ‘the burning coal’ in our bodies, is also EMF sensitive^3,^4, as is the graphene oxide interacting with lipid nanoparticles for a controlled drug (synthetic genetic material) release/delivery ^5.
QUESTIONS.
What can make the consistency of a very strong elastic WHITE rubber? Plain nanomaterials in particular metals, including fats/lipids? Metals are generating colors, so no, I doubt it. Single amyloids formed on the side walls of the blood vessels, with embedded Spikes? Not quite, the clots would be GROWN into the capillary wall structure and rip it apart when pulling on it, in my opinion. What we see is ONE CONTINUOUSLY GROWING NEW ORGAN, floating in blood, having the color and elasticity of the skin, the largest organ in the human body, but is it just within the blood vessels? What is really astonishing, is another homology of the Spike protein with the largest protein in the human body, titin ( uniprot entry code Q8WZ42.4). Here some automated BLAST results comparing SARS-CoV-2 Spike (NCBI code YP_009724390.1) sequence in the Query line and titin, a ~34,000 amino acid long protein, in the Sbjct line:
25.4 bits(54) 0.92 45/226(20%) 83/226(36%) 29/226(12%)
Query 10 LVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIH 69
+VS++ + + T++ SF + + V +SS + P S +TW
Sbjct 5955 IVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPIS-ITWLKDDQ 6013
Query 70 VSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQS-------LLIVNN 122
+ + DN + F D V A+ + ++ G T +K +S L+V
Sbjct 6014 ILDED-----DNVYISFVDSV--ATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQE 6066
Query 123 ATNVVIKV------------CEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEY 170
+V K E P L V + K+ K + S + S NN
Sbjct 6067 PAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFR 6126
Query 171 VSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDL 216
+ +M + Q FK +F + D Y ++ ++ P + + L
Sbjct 6127 IQS--VMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKL 6170
Query 224 EPLVDL-PIG-------INITR 237 SARS-CoV-2 SPike
EP V L PI INITR <<<<<IDENTITIES
Sbjct 21193 EPVVALDPIDPPGKPEVINITR 21214 <<human totin
Query 83 VLPFNDGVY--FASTEKSNII 101 <<<Spike
VLP ++G+Y FAS K N I <<<<<IDENTITIES
Sbjct 1354 VLPEDEGIYTAFASNIKGNAI 1374 <<<Titin
Query 308 VEKGIYQTSNFRVQ 321 <<<Spike
VE IY+ FRVQ <<<<<IDENTITIES
Sbjct 19093 VENQIYE---FRVQ 19103 <<<Titin
Query 154 ESEFRVYSSANN 165
E EFRVY A N
Sbjct 24419 EYEFRVY--AEN 24428
and another REPEAT further down the titin sequence:
Query 156 EFRVYSSANN 165
EFRVY A N
Sbjct 27668 EFRVY--AEN 27675
Query 1156 FKN----HTSP----------------DVDLGDISGINASVVNIQKE 1182
FKN HTS +V L DIS I A V KE
Sbjct 12534 FKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQV----KE 12576
Query 432 CVIAWN---SNNLDSKVGG----NYNYL 452
CV+AW S+ GG NY YL
Sbjct 31768 CVVAWKPPASD------GGAKIRNY-YL 31788
Query 62 VTWFHA---IHVSG 72
V+WFH I VSG
Sbjct 6758 VAWFHEKTKI-VSG 6770
Query 530 STNLVKNK 537
STNLV NK
Sbjct 22443 STNLV-NK 22449
Query 1161 SPDVD---------LGDIS 1170
SPD D LGDIS
Sbjct 33000 SPDYDFYYRPRRRSLGDIS 33018
Query 1179 IQKEIDR---------------LNEVAKNLNESL 1197
+QK+ID+ L +VAK E L
Sbjct 32832 VQKQIDKTLRMAEILSGTESVPLTQVAK---EAL 32862
and now a repeat in both, Spike and the titin
Query 306 FTVEK----GIYQTSNFRV 320
FTVE G Y+ FRV
Sbjct 17003 FTVEDLVEGGEYE---FRV 17018
Query 153 MES---EFRVY 160
ME +FRVY
Sbjct 20582 MEDTQYQFRVY 20592
Query 153 MESEFRVYSSANN 165
ME FRV SA N
Sbjct 21071 MEYTFRV--SAEN 21081
Query 808 DPSKPSK 814
DPS PSK
Sbjct 18023 DPSPPSK 18029
Query 809 PSKPSK 814
PS PSK
Sbjct 30944 PSRPSK 30949
Query 201 FKIYS----KHTPINLVRDLPQG------FSA-LE 224
FKI S K RDLP G FS LE
Sbjct 22313 FKITSYIVEK-------RDLPNGRWLKANFSNILE 22340
Query 1091 REGVFVSNGTHW 1102
RE V N THW
Sbjct 15868 RE---V-NSTHW 15875
repeats of the most conserved piece in SPike
Query 814 KRSFIEDLLFNKV 826
K SF FNKV
Sbjct 8560 KISF-----FNKV 8567
Query 814 KRSFIE 819
KR FIE
Sbjct 9993 KRVFIE 9998
Query 256 SGWTAGAAA 264
SG AGAAA
Sbjct 389 SG-AAGAAA 396
The first hit corresponds to a ~200 amino acid continuous string. There are never ending homolog pieces like that between the giant muscle protein^11 and the Spike. WHY?
Some of the ‘not being able to get digested amyloidal Spike pieces’ theories, implicate that trypsin is ‘somehow incapacitated’, to do its job. One of the inhibitors of trypsin, the major DIGESTIVE enzyme in our bodies, with anti-cancer properties, now apparently not capable of digesting the spike is: VASOPRESSIN=Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly-NH2=CYFQNCPRG-NH(2), (called AVP^12), only 9 amino-acids long (and Spike has 1273, imagine the choices here!!!) is a semicyclic endogenous peptide with the main physiological roles of regulation of water balance and the control of blood pressure and adrenocorticotropin hormone (ACTH) secretion. At this point have to remind this post:
in which Fauci’s PATENTED cyclic hexapeptide with the amino acid sequence of CWLDVC is mentioned. Here how it fits with vasopressin:
Query 1 CYFQNCPRG Vasopressin with CxxxxC motif covered by
C+ C
Sbjct 1 CWLDVC Fauci's PATENT
The N can be also substituted by D, plus the F (phenylalanine) also by W (tryptophan), but even without that, how many of those vasopressin-like peptides, will be produced AFTER the SARS-CoV-2 Spike digestion? Let’s try typical molecular biology experiment. Insert the vasopressin into the middle of the RSV polymerase (assuring proper multiplication of the respiratory virus) and compare it with SARS-CoV-2 Spike:
Query 488 CYF 490 SPIKE
CYF
Sbjct 1261 CYF 1263 RSV polymerase
This ONE HIT only is exactly the inserted into the polymerase first tripeptide from the vasopressin. How the corresponding Query Spike neighborhood residues look like?
Query 488 CYFPLQSYGFQPTNGVGYQPY.. <<<< SPIKE2020
CYF G
Sbjct 1 CYFQNCPRG <<<< VASOPRESSIN
Note that the middle non-overlapping section contains 2 more common amino acids P and Q,’ just’ in reverse direction. This CYF-segment of Spike belongs to its ACE2 receptor binding domain!!! There are 3 more Spike segments with the CxxxC motif, the C-terminal last one with multiple intertwinned cysteine residues:
CEFQFCNDPFLG <<< SPIKE2020
CTMYICGDSTEC <<< SPIKE2020
CCMTSCCSCLKGCCSCGSCCK <<< SPIKE2020
C FQ C+ + <<<< overlapping identities
CYFQNCPRG <<<< VASOPRESSIN
Since methionine M can be substituted by aromatic amino acids F,W,Y, the homology gets even greater. It is interesting that researchers already 30 years ago were injecting exactly the vasopressin mRNA in brains of rats while looking at the consequences^17, and now with billions of this time SYNTHETIC mRNA injections into real humans, nobody seems to be interested in the topic any more, except for the team from the Washington University in St. Louis School of Medicine, St. Louis, MO, who openly admits, the SARS-CoV-2 SPike is reverse transcribed by OTHER VIRAL reverse transcriptases like the one from Moloney murine leukemia virus (M-MLV) and avian myeloblastosis virus (AMV) ^18. How pity they didn’t look into HIV-1 and where the reverse transcribed cDNA can end actually….
Can we say the massive genetically driven Spike production will lead to exponentially increasing trypsin inhibition? Only time can tell. In general, introduction of viral genes which will have inhibitory function on the host molecular surviving apparatus, seems like a very evil tactics of those in power, in order to ELIMINATE the HOSTS, slowly but surely.
In the meantime, first publication announces “A broad-spectrum macrocyclic peptide inhibitor of the SARS-CoV-2 spike protein“^13.
Today, 11/19/2022, an interesting article was posted by EXPOSE at: https://expose-news.com/2022/11/29/how-covid-jabs-cause-intravascular-growths/
The title: “The Genetic Mechanism by which the COVID mRNA Jabs cause the Intravascular Growths seen in the ‘Died Suddenly’ Documentary“ written by an anonymous author, who suggests that the leftover N1-methylpseudouridine is the main reason for the artificial growth, yes the new foreign genetic nucleotide from Pfizer/Mod-E-RNA covid injections, which apparently can be recirculated in the injected victim and contribute to that uncontrolled growth. Definitely a possibility, just an idea, is there an antibody to it?? Does it exist, as an antidote?
Literature.
Michael Landreh et al. “Specific Chaperones and Regulatory Domains in Control of Amyloid Formation”J Biol Chem. 2015 Oct 30; 290(44): 26430–26436. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4646301/
Júlio C Borges, Carlos H I Ramos“Protein folding assisted by chaperones“ Protein Pept Lett. 2005 Apr;12(3):257-61. https://pubmed.ncbi.nlm.nih.gov/15777275/
also
M Beissinger 1 , J Buchner “How chaperones fold proteins” Biol Chem. 1998 Mar;379(3):245-59. https://pubmed.ncbi.nlm.nih.gov/9563819/
Michele Caraglia et al. “Electromagnetic fields at mobile phone frequency induce apoptosis and inactivation of the multi-chaperone complex in human epidermoid cancer cells“ J Cell Physiol. 2005 Aug;204(2):539-48. https://pubmed.ncbi.nlm.nih.gov/15754340/
María José Misa Agustiño et al.“Electromagnetic fields at 2.45 GHz trigger changes in heat shock proteins 90 and 70 without altering apoptotic activity in rat thyroid gland”. September 2012 Biology Open 1(9):831-8
https://www.researchgate.net/publication/233850237_Electromagnetic_fields_at_245_GHz_trigger_changes_in_heat_shock_proteins_90_and_70_without_altering_apoptotic_activity_in_rat_thyroid_gland
By Cvetelin Vasilev, Ph.D “Controlling Nanoparticle Size with Graphene Oxide and Microwave Radiation“ https://www.azonano.com/article.aspx?ArticleID=5884
including the references within:
Li, S., et al. (2021) Microwave-Enabled Size Control of Iron Oxide Nanoparticles on Reduced Graphene Oxide. Langmuir, 37 (37), 11131-11141. Available at: https://doi.org/10.1021/acs.langmuir.1c01990
Xu, S., et al. (2019) Uniform, Scalable, High-Temperature Microwave Shock for Nanoparticle Synthesis through Defect Engineering. Matter 1, 759–769. Available at: https://doi.org/10.1016/j.matt.2019.05.022
Kim, J., et al. (2019) Microwave-assisted one-pot synthesis of iron(II, III) oxide/reduced graphene oxide for an application of supercapacitor electrode. Carbon Lett., 29, 411–418. Available at: https://doi.org/10.1007/s42823-019-00045-9
Robhash Kusam Subedi et al. “Preparation and characterization of solid lipid nanoparticles loaded with doxorubicin“ Eur J Pharm Sci. 2009 Jun 28;37(3-4):508-13. https://pubmed.ncbi.nlm.nih.gov/19406231/
https://bioserine.com/blogs/news-1/l-serine-a-possible-natural-solution-to-alzheimers with further links at:
https://www.tandfonline.com/doi/full/10.1080/21678421.2016.1221971
“L-serine in disease and development.“ https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1223326/
https://www.alzdiscovery.org/cognitive-vitality/ratings/l-serine and all the 12 references mentioned in it, here listed for the convenience:
Biemans EA, Verhoeven-Duif NM, Gerrits J et al. (2016) CSF d-serine concentrations are similar in Alzheimer's disease, other dementias, and elderly controls. Neurobiol Aging 42, 213-216.
Hashimoto K, Fukushima T, Shimizu E et al. (2004) Possible role of D-serine in the pathophysiology of Alzheimer's disease. Prog Neuropsychopharmacol Biol Psychiatry 28, 385-388.
Hirabayashi Y, Furuya S (2008) Roles of l-serine and sphingolipid synthesis in brain development and neuronal survival. Prog Lipid Res 47, 188-203.
Zhai PP, Xu LH, Yang JJ et al. (2015) Reduction of inflammatory responses by L-serine treatment leads to neuroprotection in mice after traumatic brain injury. Neuropharmacology 95, 1-11.
Monahan JB, Corpus VM, Hood WF et al. (1989) Characterization of a [3H]glycine recognition site as a modulatory site of the N-methyl-D-aspartate receptor complex. J Neurochem 53, 370-375.
Chouinard ML, Gaitan D, Wood PL (1993) Presence of the N-methyl-D-aspartate-associated glycine receptor agonist, D-serine, in human temporal cortex: comparison of normal, Parkinson, and Alzheimer tissues. J Neurochem 61, 1561-1564.
Nagata Y, Borghi M, Fisher GH et al. (1995) Free D-serine concentration in normal and Alzheimer human brain. Brain Res Bull 38, 181-183.
Cox PA, Davis DA, Mash DC et al. (2016) Dietary exposure to an environmental toxin triggers neurofibrillary tangles and amyloid deposits in the brain. Proc Biol Sci 283.
Dunlop RA, Cox PA, Banack SA et al. (2013) The non-protein amino acid BMAA is misincorporated into human proteins in place of L-serine causing protein misfolding and aggregation. PLoS One 8, e75376.
Bradley WG, Miller RX, Levine TD et al. (2017) Studies of Environmental Risk Factors in Amyotrophic Lateral Sclerosis (ALS) and a Phase I Clinical Trial of L-Serine. Neurotox Res.
Levine TD, Miller RG, Bradley WG et al. (2017) Phase I clinical trial of safety of L-serine for ALS patients. Amyotroph Lateral Scler Frontotemporal Degener 18, 107-111.
Stark AC (2017) Phase IIa L-serine Trial for eAD (LSPI-2). ClinicalTrials.gov.
https://alzheimersnewstoday.com/news/amino-acid-l-serine-may-reduce-memory-loss-in-alzheimers-disease-study-suggests/
https://brainchemistrylabs.org/news-blog/2022/5/4/l-serine-a-naturally-occurring-amino-acid-and-alzheimers-disease
https://pubmed.ncbi.nlm.nih.gov/16949547/
“Trypsin inhibition by a peptide hormone: crystal structure of trypsin-vasopressin complex” J Mol Biol. 2005 May 20;348(5):1191-8. https://pubmed.ncbi.nlm.nih.gov/15854654/
and
https://pubmed.ncbi.nlm.nih.gov/16114100/
https://www.biorxiv.org/content/10.1101/2022.11.11.516114v1.full.pdf
Maria Chiara di Gregorio et al. “Physiology and Physical Chemistry of Bile Acids“ Int. J. Mol. Sci. 2021, 22, 1780.
Subramanian, S.; Iles, T.; Ikramuddin, S.; Steer, C.J. Merit of an Ursodeoxycholic Acid Clinical Trial in COVID-19 Patients. Vaccines 2020, 8, 320. https://pubmed.ncbi.nlm.nih.gov/32575350/
Carino, A.; Moraca, F.; Fiorillo, B.; Marchianò, S.; Sepe, V.; Biagioli, M.; Finamore, C.; Bozza, S.; Francisci, D.; Distrutti, E.; et al.
Hijacking SARS-CoV-2/ACE2 Receptor Interaction by Natural and Semi-Synthetic Steroidal Agents Acting on Functional Pockets on the Receptor Binding Domain. Front. Chem. 2020, 8, 1–15.Jirikowski G.F., Sanna P.P., Maciejewski-Lenoir D., Bloom F.E., Paolo S.P., Dominique M.-L. Reversal of diabetes insipidus in Brattleboro rats: intrahypothalamic injection of vasopressin mRNA. Science. 1992;255:996–998.
Kyusik Q. Kim et al. “N1-methylpseudouridine found within COVID-19 mRNA vaccines produces faithful protein products” Cell Rep. 2022 Aug 30; 40(9): 111300. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9376333/pdf/main.pdf
It is sad that we all just explain away what is happening. If I were writing a SCI-FI book, I would have a totalitarian government that had too many old people and sick people that it had to care for and looking for a common cold type virus that could kill them off to make live better for the remaining billion people in my country.
I would seek the aid of people in other world governments as well that may have similar aims to reduce population for various reasons. Then leak the virus and watch what happens.
Then I would create a mandatory injection that also kills off the weak as well and causes heart attacks and strokes in the rest of the people. Fast and not slow death. If I can also compromise the immune systems of these people it would be a trifecta
Link to preview