The untold story of Dr. Bret Weinstein, Yuri Deigin and 'RGD' motif in SARS-CoV-2 Spike protein, essential in SYNTHETIC biology

Update 1/9/2024 : This is what Dr. Bret Weinstein has to say, in Jan 2024: https://forbiddenknowledgetv.net/bret-weinstein-exposes-the-world-health-organizations-dark-agenda/, praising the ‘wonderful technology’ without saying that it is all synthetics!

Update: 3rd of May 2022 (at the end of this post)

Update 8/20/2023: A July 2023 new publication titled “Are the integrin binding motifs within SARS CoV-2 spike protein and MHC class II alleles playing the key role in COVID-19?“ states, a quote “The previous studies on the RGD motif (aa403-405) within the SARS CoV-2 spike (S) protein receptor binding domain (RBD) suggest that the RGD motif binding integrin(s) may play an important role in infection of the host cells.“ and the most important, quote “Accordingly, infected HLA-DRB1*03:01 or HLA-DRB3*01.01 positive individuals may develop high affinity anti-RGD motif antibodies that react with the RGD motif in the host proteins, like fibrinogen, thrombin or von Willebrand factor, affecting haemostasis or participating in autoimmune disorders.“ All at: https://www.frontiersin.org/articles/10.3389/fimmu.2023.1177691/full

Update: 5th of May 2022, addition about snake venom proteins

Early 2020 Dr. Bret Weinstein interviewed a young russian origin individual with the name Yuri Deigin, who says about himself, quote: ‘Preventing death is my life’s mission. I am a drug developer currently working on a rejuvenating gene therapy using the approach of partial reprogramming.’ The interview is available at:

https://cogres.org/health-wellbeing/bret-weinstein-and-yuri-deigin-did-covid-19-leak-from-a-lab/

Dr. Weinstein also interviewed Dr. Malone, the inventor of the original mRNA GENE THERAPIES, which the same person today, falsely calls ‘vaccines’ (covid injection products):

https://childrenshealthdefense.org/defender/censored-dark-horse-podcast-bret-weinstein-robert-malone-inventor-mrna-vaccine-technology/

Yuri’s web pages at:

https://yurideigin.medium.com/lab-made-cov2-genealogy-through-the-lens-of-gain-of-function-research-f96dd7413748

and at https://lifeboat.com/ex/bios.yuri.deigin

feature an incredible amount of knowledge across genetics, virology, structural biology applied on the SARS-CoV-2 virus. Like the indian researchers who concentrated more on the SARS-CoV-2 and HIV connection, he tried to proof the lab origin from the ‘furin side’ insertion perspective. This was HUGE news in 2020, already pointing to a question about the entire pandemic, and that was around the same time when the first modified synthetic genetic material injections on real people started. What Deigin never mentioned was another motif inside of the amino acid sequence for the synthetic SARS-CoV-2 Spike, the Arg-Gly-Asp (RGD) motif. That insertion is right before the ACE2 Receptor Binding Domain (RBD). The RGD peptide sequence is a recognition sequence for integrin receptors through which mammalian
cells connect to their ECM molecules.

HIV spike doesn’t have the ‘RGD’, Urbani corona doesn’t have it, the ToR2 2003 corona doesn‘t have it, MERS doesn’t have it, even the nearest ~97% IDENTICAL with SARS-CoV-2 (https://www.ncbi.nlm.nih.gov/nuccore/MN996532) Bat coronavirus RaTG13 does NOT have it. But, the ‘Human gammaherpesvirus 4’ has it, in 26 places across the entire viral genome, with one of those sequences containing 6 of the RGD motifs in one string at: https://www.ncbi.nlm.nih.gov/nuccore/82503188 , because of its incredible ‘man made’ characteristics (which also includes countless homologs of the furin site), is pasted at the end of this note. That protein is known as Epstein-Barr nuclear antigen leader protein. As of today, 9/30/2022, sales of GSK’s shingles vaccine, Shingrix, was the main driver of growth. Shingrix sales more than doubled in the second quarter, being April to June 2022, pushing up total GSK sales by 13%.

https://dailysceptic.org/2022/09/29/is-the-real-covid-pharmaceutical-bonanza-just-getting-started/

Since I know personally few people who right after the covid shot developed shingles, the question would be: do covid injections somehow ‘prime’ the recipients for the new disease?

In a ~3300 pages book about Synthetic Biology by Paul Ducheyne from 2011 titled: “Comprehensive Biomaterials“ the letters ‘RGD’ are mentioned >780 times. Just two quotes one from p. 470 describing its application: “Hsu et al.1806) fabricated small diameter polyurethane (Pellethane 2363-80A) vascular grafts modified by epoxy-
cross-linked gelatin and an RGD-containing protein to facilitate the endothelial cell seeding on the surface.“ and the other from p. 508: “The tripeptide arginine-glycine-aspartic acid (RGD) has been used widely as an adhesive motif to mediate cell
adhesion to synthetic materials (for complete reviews, please refer to Hersel et al.46 and Shin et al.47). Although it is an oversimplification of the dynamic interface provided by the combination of the BM proteins, RGD can encourage cell adhesion,48 spreading, and migration.49 “

RGD is the universal integrin binding motif, investigated decades ago, by a russian, Prof. V. I. Deigin who has his profile at: https://www.researchgate.net/profile/Vladislav-Deigin-3

His 1989 publication titled:”DEPENDENCE OF PLATELET AGGREGATION RESPONSE ON ARGINYL-GLYCYL-ASPARAGINE TRIPEPTIDE”.

Prof. Deigin describes his study of the action of exogenously added fibronectin(FH) on Platelet Aggregation Response(PAR) and also the effect of binding of endogenous FN with specific antibodies (AB), and the action of the synthetic tripeptide arginyl-glycyl-asparagine (RGD), which is an amino-acid sequence found in the region (domain) of the FN molecule which interacts with the cell receptors of platelets and other cells [7], on PAR. He concludes with, quote:

“It can thus be concluded that RGD, which is a common amino-acid sequence of a number of adhesive proteins [4], such as fibrinogen, FN, collagen, Willebrandt's factor, thrombin, etc., not only inhibits their binding with the surface of platelets [7], and thereby reduces platelet adhesion to various substrates, but also inhibits platelet aggregation, in all probability for the same reason. This is evidence of the need for protein aggregation cofactors (including FN) to participate in this process.

I’d just want to know one thing, is Yuri Deigin related to V.I. Deigin? And if so, why he never spoke about the RGD motif, which also addresses the issues of prions (the Creutzfeldt–Jakob diseases) and biofilms? And why so few people got that interview and were not warned early enough before getting covid jabbed???

/translation="MGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPR
                     RVRRRVLVQQEEEVVSGSPSGP-RGD-RSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSP
                     TRGGQEPRRVRRRVLVQQEEEVVSGSPSGP-RGD-RSEGPGPTRPGPPGIGPEGPLGQLL
                     RRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGP-RGD-RSEGPGPTRPGPPGIGP
                     EGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGP-RGD-RSEGPGPTR
                     PGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGP-RGD-R
                     SEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGS
                     PSGP-RGD-RSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQ
                     EEEVVSGSPSGPLRPRPRPPARSLREWLLRIRDHFEPPTVTTQRQSVYIEEEEDED"

The above sequence represents the 82503188 entry in NIH nuccore genomic data base at https://www.ncbi.nlm.nih.gov/nuccore/82503188 for the EBV nuclear antigen leader protein, which has SIX (6) RGD motifs, SIX (6) furin sites homologs (PRRVRRR), SIX (6) ‘EEE’ motifs, and the C-terminal VMAT-2 antibody section. If that is all is a conincidence, then that would explain why there is no Nobel prize in mathematics!

First after Dr. Bryan Ardis association between SARS-CoV-2 Spike and snake venoms I came across a review titled: “Snake Venom Peptides: Tools of Biodiscovery“ by Aisha Munawar et al. Toxins 2018, 10, 474; doi:10.3390/toxins10110474 which actually mentions the very same ‘RGD’ motif, but not in association with integrins, but rather with snake DISINTEGRINS.. The Figure 3. from that publication is attached below. It shows:

(A) Ribbon diagram of the crystal structure of Trimestatin (a snake venom disintegrin).
The figure illustrates cysteine residues forming disulfide bonds in yellow, while the tripeptide sequence (RGD) binding motif is shown in pink. (B) The tripeptide sequence motifs of various snake venom disintegrins having different intermolecular interactions are shown with reference to their specificity.

The SARS-CoV-2 Spike has not only the RDG motif, like no other of the corona viruses have, between the amino acids 403-405, but also the KTS tripeptide between 733-735, divided by the well known furin site, thus having these disintegrin motifs on both Spike domains S1 and S2, even after their cleavage in the moment of its activation. The above shown RGD- and PRRVR-rich (furin site homolog) sequence at https://www.ncbi.nlm.nih.gov/nuccore/82503188 , is a content of a in 2013 filed french patent US 9.915,662 B2 titled: “PROTEIN MICROARRAY FOR CHARACTERIZING THE SPECIFICITY OF THE MONOCLONAL IMMUNOGLOBULINS OF MGUS OR MYELOMA PATIENTS” for that SEQ ID NO: 18, EBV specific anti-gen. This is a special patent, since it presents a ‘characterization method’ for almost all viruses and pathogenic bacteria, among which the detection of cytomegalovirs, hepatitis C virus and the Epstein Barr virus is based on proteins containing that RGD motif. The patent does not mention any connection of its content with snake venoms.

Thus, if it was NOT for Dr. Bryan Ardis, who came up with the SARS-CoV-2 Spike and snakes connection, I would not know that integrins are equally important as the disintegrins are!!!

Simple explanation of the content of this post: The obvious covid crime was initiated for that one purpose, to inject every human being on this planet with gene modifying covid19 concoctions, shots which include synthetic GENETIC material, LIPID nanoparticles, multiple specified and some unspecified chemicals, like graphene. In a sense, the injected covid19 concoction can be viewed indeed as a ‘theoretical VIRUS’ which by definition is a foreign GENETIC MATERIAL encapsulated by the lipids (Celeste Solum from FEMA has a special name for it). This post describes an essential TRIPEPTIDE ‘arginine-glycine-aspartic acid’ encoded by that genetic material. RGD motif is NOT foreign, but rather was originally identified as the amino acid sequence within the extracellular matrix protein fibronectin that mediates cell attachment, both in humans and in snake venoms.

Mr. RF Kennedy describes in his ‘The Real Anthony Fauci’ book, the history of the AIDS scam, in which HIV-1 ‘discovery’ was followed by new Gallo’s discovery of the really infectious human herpesvirus HHV-6A, the herpes family, from which stems the above sequence with FIVE ‘RGD’ motifs and with the highly artificially looking pattern, that’s why patented..

Lipids are NOT encoded by the genetic code, only proteins. This is essential for the formation of many viruses, which contain the lipid coating. The necessity of genetic material crossing the lipid cellular membrane during so called ‘viral budding’, the packaging of the viral material is so irreproducible, that this could explain why so few generally ‘viral’ crystallographic data are present, and definitely NONE from coronaviruses, being the LARGEST ones. The release of the genetic material by the human body in form of exosomes, happens always from INSIDE to OUTSIDE of every cell. The covid19 crimial, illegal injections are for the first time in the human history crossing the human cell membranes in the opposite direction, partly directly into the lymph and blood system!

One of the great researchers on the field of viral proteins was Don C. Wiley, who worked among others on the gp120, the HIV protein, pieces of sequences of which were embedded into the SARS-CoV2 Spike protein. Unfortunately this talended Harvard researcher died mysteriously in 2001. Let’s hope it was not this kind of ‘just on time’, like in Dr. Kary Mullis’ case. The one and only reason for the deceptive 2020 pandemic is a RT-PCR test, which is not capable by definition, of any detection of an active infection.