Why CDC/FDA ignore the Spike protein functional relationships and bioiformatics

8/1/2022: update with addition to other substack site which is looking into published studies of some of the proteins related to SPike, mentioned in this post.

In 2021 CHD (Childrens Health Defense) and ICAN requested comments submission from their readers who were expressing their concerns to the FDA about the new 2021 covid injections. Before publishing the comments on FDA web pages, they ‘approve them’, which resulted in my comments never appearing among the submissions of the concerned citizens. Here are some of the submitted points with small changes, which I wrote in May 2021.

The emergency approval of covid-19 synthetic modified mRNA injections in Dec 2020 both for Pfizer and ModERNA was performed by a highly biased committee, which didn't investigate the essential basic questions, how toxic the spike protein is, how toxic are all the nanomaterials imbedded in the injection materials, how much of the produced spike is turning into neutralizing antibodies, how deeply the entire energetic balance of human metabolism is affected by the genetic artificial ribosome activation. No questions were answered in terms of how many other human metabolic processes in the same time of the genetic manipulations within human cells, suffer, only because of loss of human function initiated by the artificial interfering with own human mRNA transcription, and that only to now produce viral 100% synthetic Spike
protein with higher priority in all accessible human cells! The proof of efficiency of the ‘vaccines’ based on PCR tests, which by definition are incapable of determining the presence of any infection, is a complete fraud.
Accepting the entire manufacturing process without any details of:
-physical, chemical characteristics of all the compounds
-no toxicity assessment (not even on animals. to do it immediately with healthy humans is completely unethical!)
-no molecular, cellular, tissue and whole animal testing of any of the products (!)
only because of proprietary industrial rules, is unacceptable in a situation where 'safety and efficacy' might have the human life at stake, which is exactly the case right now.

SARS-CoV-2 (viral entry NIH code NC_045512.2) spike protein (YP_009724390.1), whose genetic code is embedded into all current covid-19 injections (with few amino acids difference), has an extremely complex, questionable and highly concerning amino acid pattern.
Since that Spike protein binds to the Angiotensin-converting enzyme 2 (ACE2), the natural ACE2 binding partners in a healthy human, will be clearly affected by the presence of the synthetic Spike after Pfizer/Mod-E-RNA injections, in particular, if in a cell volume suddenly thousands of copies of the Spike are being produced, while using the synthetic genetic code in form of the modified mRNA, and depriving the cell of all the ingredients necessary in the same time for HUMAN proper functioning.

According to Uniprot, entry Q9BYF1 (ACE2_HUMAN) ACE2 is a critical regulator of blood volume, systemic vascular resistance, and thus cardiovascular homeostasis with the following functions:
1. Conversion of angiotensin I to angiotensin 1-9
2. Conversion of angiotensin II to angiotensin 1-7
3. removes the C-terminal residue from three other vasoactive peptides, neurotensin, kinetensin, and des-Arg bradykinin
4. cleaves other biological peptides, such as apelins (apelin-13, [Pyr1]apelin-13, apelin-17, apelin-36), casomorphins (beta-casomorphin-7, neocasomorphin) and dynorphin A with high efficiency
5. ACE2 C-terminus is homologous to collectrin and is responsible for the trafficking of the neutral amino acid transporter SL6A19 to the plasma membrane of gut epithelial cells via direct interaction, regulating its expression on the cell surface and its catalytic activity
6. regulated by chloride and fluoride(!).

With so many essential physiological processes involving ACE2, to introduce a 100% synthetic viral protein binding to it, while not performing any bioinformatics research, is a serious failure. In particular the amount of the produced Spike, as it is in the case with the not degraded modified mRNA in these genetic treatments of millions, is completely irresponsible. Just recently, it was shown that alone the Spike effect on endothelial cells is extremely damaging^1. Injection of genetic code of the synthetic Spike protein into humans, with the possibility of being genetically manipulated, without a consent of the million’s of recipients^2, ^3, is a crime. Even Salk researchers addressed the deleterious function of the spike in human beings^4. The most recent official statements^4 are going into even more details of where the Spike proteins, via accumulations of the accompanying nanomaterials, are actually being expressed in human body. Many pharma independent researchers are extremely concerned because of the above-mentioned fact, that the spike reacts with many human tissues, alone because of the ACE2 binding^5, ^6 via its RBD domain.

Equally disturbing is the fact, that many essential pieces of covid spike protein were already patented, years back, before the 2020 'outbreak'. An example of a peptide KRSFIEDLLFNKV^7 absolutely conserved among coronaviruses, was patented in 2009 as a part of a 'receptor binding polypeptide (US 7491397-A 196 17-FEB-2009), then in 2013 its more extended version as a 'SARS vaccine compositions...' (US
8506968-B2 149 13-AUG-2013), then with few more amino acids as a 'Ii-key/antigenic epitope hybrid peptide vaccines'(US 8815249-B2 1149 26-AUG-2014), and now it can be found within entire patented spike as 'Stabilized coronavirus spike (S) protein immunogens and related vaccines'(US 10906944-B2 39 02-FEB-2021).
Not only that, but on the same day an 'Intranasal vector vaccine against porcine epidemic diarrhea'(US 10905758-B2 2 02-FEB-2021) was patented, with the very same fragment, and the entire porcine flu spike which has >30% identities with the 2020 coronavirus spike protein!

In 2020 two researchers^8 analyzed the spike protein for homologies with human proteomes, specifically with hexa- and heptapetides and the result was, quote:
"A massive peptide commonality is present with humans and mice, i.e., organisms that undergo pathologic consequences following SARS-CoV-2 infection. Instead, no or a lowest number o f common peptides are present in mammals that have no major pathologic sequelae once infected by SARS-CoV-2 [10–12]. Hence, the data appear to be an indisputable proof in favor of molecular mimicry as a potential mechanism that can contribute to or cause the SARS-CoV-2 associated diseases."

To expand the above searches for homologies between the SARS-Cov-2 Spike protein and many other important known proteins, it is essential to know a specific protein, related to side effects seen in injected participants. Here are some of these homologies using the NIH genome data base. All comparisons are done using BLAST software and given codes for other test trial proteins. All proteins were tested with constant input default parameters. Starting with just few more detailed examples of the resulting homologies:

1. gp160 HIV (Envelope surface glycoprotein gp160, precursor) NP_057856.1
Sequence Coverage IDENTITIES
20.4 91% 0.68 27.27% P04578.2
Just one example of these alignments, a critical HIV fragment:
Query 1205 KYEQYIKWPWYIWLGFIAGLIAIVMVT 1231 (COVID spike protein)
___ KY+ _ +W W W + G++ I T ======>IDENTITIES
Sbjct 6 KYQHLWRWGWR-WGTMLLGMLMICSAT 31 HIV gp160=gp120+gp41
the in SARS-CoV-2 spike newly introduced furin site, aligned by hand (becasue BLAST won’t do it) with the HIV homolog:
PRRARSVASQ =====>covid spike
PRR_R ======>Identities
PRRIRRQGLE ======>HIV glycoprotein

2. NP_037163.1 human VMAT-2 protein (encoded by s.c. God gene) versus SARS-CoV-2 Spike:

Query 275 RVQP 278 ======>VMAT2 (synaptic vesicular amine transporter)
RVQP =======>IDENTITIES
Sbjct 319 RVQP 322 ========>Spike
Query 374 LCIPFA 379 =====>VMAT2 (synaptic vesicular amine transporter)
L IPFA ======>Identities
Sbjct 894 LQIPFA 899 ======> Spike
Query 46 SYLYSIKHEKN--------STEI 60 =====> VMAT-2
+YLY + + N STEI ======>IDENTITIES
Sbjct 450 NYLYRLFRKSNLKPFERDISTEI 472===> Spike’s RBD domain section

Synthetic peptide corresponding to Human VMAT2 portion aa 502 -514 (C terminal) is commercially available in order to inhibit VMAT-2 function, yet its homologous sequence, having all charged residues conserved, is literally at the very C-terminal of the Spike (D-aspartic acid is equivalent to E-glutamic acid due to their identical negative charge):

C-SYPIGEDEESESD ==>commercial VMAT-2 antibody
C-CKF—DEDDSE--===> Covid-Spike

In the following short BLAST tests results for searches of similarities between Spike and other randomly chosen proteins, the 'sc' stands for sequence coverage and 'id' stands for identities:

- anthrax toxin (80% sc, 34% id), bioweapon
- ricin toxin (80% sc, 48% id), bioweapon
- tetanus neurotoxin (75% sc, 35% id), bioweapon
- pseudomonas EXOTOXIN A (95% sc, 35% id)
- botulin toxin from Clostridium botulinum (89% sc, 43% id)
- human p53 (86% sc, 25% id), cancer related
- putrescine (71%sc, 40% id), angiogenesis and polyamine biosynthetic process
- cadaverine (67% sc, 26% id)
- prothrombin (41% sc, 33% id), blood homeostasis, clotting, inflammation and wound healing
- HSP70 (16% sc, 26% id), proper folding of proteins
- HCG (68% sc, 29% id), infertility
- FSHR (94% sc, 44% id), pregnancy, menstruation
- Hemoglobin (41% sc, 25% id), oxygen delivery
- acetylcholinesterase (28% sc, 52%% id), signal transduction at the neuromuscular junction
- surface glycoprotein from Agrotumefaciens (48% sc, 41% id), tumors in plants
- human trypsin (85% sc, 26% id), essential digestive enzyme
- human rhodopsin (87% sc, 38% id), image forming vision at low light intensity
- syncitin-1 (91% sc, 30% id)
- marburg virus assemblyVP40 (55% sc, 38.5% id) : most lethal virus assembly protein
- synthetic EPSPS (96% sc, 29.2% id) : herbicide resistance
- cry2Ab (89% sc, 24% id) : insecticide resistance
- cryA1 (96% sc, 29% id)
- HIVgag pol (94% sc, 25.5% is)
- HIVmatrix protein (70% sc, 23% id)
- HIVgp160 surface glycoprotein (93% sc, 30% id)

-human Cellular tumor antigen p53 (60% sc, 80% id)
- human prion protein (92% sc, 33.3% id)
- human cd4 protein (95% sc, 30 id)
- ebola matrix protein (65% sc, 43%)
- HIV reverse transciptase (98% sc, 37% id)
- human growth arrest protein (83% sc, 32% id)
- nagalase (97% sc, 50% id)
- human Ca+2 binding protein (90% sc, 26% id)
- human contactin, neural recognition (90% sc, 28% id)
- human complement factor B (96% sc, 44% id)
- human tumor necrosis factor (91% sc, 53% id)
- transposase from MUSCA DOMESTICA (83% sc, 48% id)
- transposase human=histone lysine N-methyltransferase (95% sc, 34% id)
- human cannabinoid receptor 1 (95% sc, 45% id)
- human cannabinoid receptor 2 (93% sc, 39% id)
- human myc-proto-oncogene protein (78% sc, 50% id)*

- human Krueppel-like factor 4, transcription factor (76% sc, 40% id)
- human Oct4 transcription factor (82% sc, 25% id)
- human Sox2 trasncirption factor (63% cs, 38% id)
- human Lin28 transcription factor (83% sc, 45% id)
- vaccinia virus decoyprotein (96% sc, 29% id)
- SARS-CoV-2 nucleocapsid phosphoprotein (67% sc, 37% id) <= the same from PCR tests
- human SiRT1 cell regeneration (77% sc, 24% id)
- human coagulation factor VII (75% sc, 45% id)
- human coagulation factor VIII (94% sc, 32% id)
- human coagulation factorIX (97% sc, 31% id)
- human coagulation factorX (85% sc, 35% id)**
- human coagulation factorXI (89% sc, 22% id)
- human coagulation factorXII (82% sc, 35% id)
- crispr-associated endonuclease cas9 Streptococcus thermophilus (93% sc, 21% id)
- crispr-associated endonuclease cas1 Pseudomonas aeruginosa (91% sc, 62% id)***
- light harvesting protein from Rhodobacter sphaeroides (81% sc, 35% id)****
- human aquaporin 1 (97% sc, 37% id)*****
- human aromatase, with testosteron as substrate (97% sc, 21% id)
- human semenogelin-1, no 1 protein in semen (98% sc, 28% id)******
- human neurotensin receptor type 1 (80% sc, 47% id)*******
- human neurotensin, i.e. neuromedin (78% sc, 58% id)
- human ferritin heavy chain (96% sc, 30% id)
- human ferritin light chain (92% sc, 55% id)********

-human LINE-1 retrotransposon (76% sc, 50% id)

-human SCN5A sodium channel protein type 5 subunit alpha (92% sc, 56% id)

-human PIEZ-1 Piezo-type mechanosensitive ion channel component1 (90% sc, 34% id)

the contactin and complement factor B proteins are predictive biomarkers of cardiovascular disease (CVD). These are just personally chosen examples, and they do not contain obviously all the proteins 'inside of spike'.

Based on these examples, all of the covid19 ‘injection’ products should have never been approved, not even for ‘emergency’, which according to the mentioned result from the first 2020 Pfizer and Moderna published data, was and still is, not even there. The complexity of all the processes in which ACE2 is involved in human body, entirely excludes any ‘safety’ guarantee after not even a 2 month process of design and fabrication of all these synthetic biotechnology entities.

…

The death rates among Moderna/Pfizer first injections recipients for their very first clinical trial studies, were ~20x smaller than average death rate in 2018, questioning the pandemic very existence to start with! On the other hand, the studies used for the emergency approval clearly showed that ~90% of the participants had serious side effects. The statistics leading to efficiency of 95% was completely flawed! And the final omission of all the site effects in the final decision begs the question: how an emergency approval actually work, while ignoring so many scientific facts, to such an extent, that only the final current death and injuries counts have to indicate, something is totally wrong here.

================

Anyone who saw the list of possible ‘side effects’ of covid injections, can hopefully now understand why it is so huge. The saying ‘you are what you eat’ has something in it, the ingredients list. Every amino acid counts, every dimer, trimer, etc. counts, in particular when you realize that GLYCINE alone on its own, functions as a HUMAN INHIBITING NEUROTRANSMITTER! Lot of specific small peptides are functioning as neurotransmitters, opioids. To take apart a human body we need enzymes, and they always cut inbetween certain defined residues. These cuts decide about all other signals down the line, including the immune response of the cell in case that peptide is foreign. Take the dipeptide ‘PF’=Proline-Phenylalanine for example. There are 9 of those in Spike sequence. What do they do after Spike digestion? They inhibit ACE2. How many ‘YR’=Tyrosine-Arginine are in the Spike? 2. That’s s.c. Kyotrophin, ‘renamed’ by some, with features described at:

https://pubchem.ncbi.nlm.nih.gov/compound/kyotorphin#section=Biologic-Description

that’s a neuroactive dipeptide which plays a role in pain regulation in the brain. Yes, every single amino acid counts, the charged ones, the aromatics ones, and even the simplest Glycine (G=Gly), once again, the human inhibiting neurotransmitter, of which over 80 are ‘embedded’ into the Spike genetic code. Or take for example L-DOPA, one of the precursors to another hugely important neurotransmitter, dopamine, that’s derived from a single, simple TYROSINE (Tyr=Y , a single letter code)! How many of those are USED to produce a single molecule of the universal biweapon injected into billions?? FIFTY FOUR tyrosines are in ONE spike. The aromatic amino acids, including tyrosine, have to be delivered via food into human bodies, that’s why it is decisive to know, if you want to survive the covid genetic modification therapy in form of the covid shot, you better eat GOOD FOOD, no GMO’s.

Those original compounds given to us by our creator were and are always the best, and they are NOT PATENTABLE.

A new great post at:

Publications worth mentioning

touches the reproduction issue in connection with HCG and Fshr proteins.

The 1987 patent related to SARS-CoV-2 Spike titled “New antigenically active proteins and peptides, and infectious bronchitis virus (IBV) vaccines“ EP 0221609-A1 13-MAY-1987; filed by DUPHAR INTERNATIONAL RESEARCH B.V contains the peplomeric protein which has 37% identity with the SPike. BLAST alignment shows the conservation of the S2 domains of those 2:

364 bits(935) 7e-111 Compositional matrix adjust. 202/548(37%) 299/548(54%) 22/548(4%)

Query  583   NVLIPNSFNLTVTDEYIQTRMDKVQINCLQYVCGNSLDCRDLFQQYGPVCDNILSVVNSI  642
             ++ IP +F ++VT E +   M K  ++C  Y+CG+S +C +L  QYG  C  +   +  I
Sbjct  711   SIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGI  770

Query  643   GQKEDMELLNFYSSTKPAGFNTPFLSNVSTGEFNISLLLTTPSSPRRRSFIEDLLFTSVE  702
               ++D      ++  K   + TP + +   G FN S +L  PS P +RSFIEDLLF  V 
Sbjct  771   AVEQDKNTQEVFAQVKQI-YKTPPIKDF--GGFNFSQILPDPSKPSKRSFIEDLLFNKVT  827

Query  703   SVGLPTDDAYKNCTAGPLGFLKDLACAREYNGLLVLPPIITAEMQTLYTSSLVASMAFGG  762
                      Y +C        +DL CA+++NGL VLPP++T EM   YTS+L+A     G
Sbjct  828   LADAGFIKQYGDCLGDIAA--RDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSG  885

Query  763   IT----AAGAIPFATQLQARINHLGITQSLLLKNQEKIAASFNKAIGRMQEGFRSTSLAL  818
              T    AA  IPFA Q+  R N +G+TQ++L +NQ+ IA  FN AIG++Q+   ST+ AL
Sbjct  886   WTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASAL  945

Query  819   QQIQDVVNKQSAILTETMASLNKNFGAISSVIQEIYQQLDAIQANAQVDRLITGRLSSLS  878
              ++QDVVN+ +  L   +  L+ NFGAISSV+ +I  +LD ++A  Q+DRLITGRL SL 
Sbjct  946   GKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQ  1005

Query  879   VLASAKQAEHIRVSQQRELATQKINECVKSQSIRYSFCGNGRHVLTIPQNAPNGIVFIHF  938
                + +      +     LA  K++ECV  QS R  FCG G H+++ PQ+AP+G+VF+H 
Sbjct  1006  TYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHV  1065

Query  939   SYTPDSFVNVTAIVGFCVKPANASQYAIVPANGRGIFIQVNGSYYITARDMYMPRAITAG  998
             +Y P    N T     C         A  P    G+F+     +++T R+ Y P+ IT  
Sbjct  1066  TYVPAQEKNFTTAPAIC-----HDGKAHFPR--EGVFVSNGTHWFVTQRNFYEPQIITTD  1118

Query  999   DIVTLTSCQANYVSVNKTVITTFVDNDDFDFNDELSKWWNDTKHELPDFDKFNYT---VP  1055
             +     +C      VN TV        D  F +EL K++ +  H  PD D  + +     
Sbjct  1119  NTFVSGNCDVVIGIVNNTVYDPLQPELD-SFKEELDKYFKN--HTSPDVDLGDISGINAS  1175

Query  1056  ILDIDSEIDRIQGVIQGLNDSLIDLEKLSILKTYIKWPWYVWLAIAFATIIFILILGWVF  1115
             +++I  EIDR+  V + LN+SLIDL++L   + YIKWPWY+WL      I  +++   + 
Sbjct  1176  VVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLC  1235

Query  1116  FMTGCCGC  1123  <<-1987 peplomeric protein (CAA01736.1)
              MT CC C
Sbjct  1236  CMTSCCSC  1243  <<-2020 Spike protein

parts of the RBD domains:
Query  665  PFLSNVST  672
            PF  ++ST
Sbjct  463  PFERDIST  470
Query  465  YTYALKEKAKYQCKLGYVTADGETSGSITC-GKDGWS  500
            Y Y L  K+  +     ++ +   +GS  C G +G++
Sbjct  451  YLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFN  487
the furin site:
Query  15   ICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQ  47
            IC +       PRR   + + S    T   G +
Sbjct  670  ICASYQTQTNSPRRARSVASQSIIAYTMSLGAE  702
Query  210  CKSPDVINGSPISQKIIYKENERFQYKCNMGYEYS  244
            C S      SP   + +  ++    Y  ++G E S
Sbjct  671  CASYQTQTNSPRRARSVASQS-IIAYTMSLGAENS  704
even the C-terminals, which are not found by BLAST, so by hand:
LILGWVFFMTGCCGCCCGCFGIMPLMSK-CGKKSSY <<1987 peplomeric protein (CAA01736.1)
 +  ++  MT CC C  GC    +  +K     S
MVTIMLCCMTSCCSCLKGCCSC-GSCCKFDEDDSEP <<2020 Spike (lipids binding section)

Literature
1. SARS-CoV-2 Spike Protein Impairs Endothelial Function via Downregulation of ACE 2. Yuyang Lei et al. Circulation Research. 2021;128:1323–1326

https://www.ahajournals.org/doi/10.1161/CIRCRESAHA.121.318902

2.Worse Than the Disease? Reviewing Some Possible Unintended Consequences of the mRNA Vaccines Against COVID-19. Stefanie Seneff &. Greg Nigh. International Journal of Vaccine Theory, Practice, and Research2(1), May 10, 2021 Page | 402-443.

3.3. https://www.eurekalert.org/pub_releases/2021-04/eb-gcm041621.php
4. https://www.salk.edu/news-release/the-novel-coronavirus-spike-protein-plays-additional-key-role-in-illness/
And most recent statements with corresponding sources, available at:
https://www.lifesitenews.com/news/vaccine-researcher-admits-big-mistake-says-spike-protein-is-dangerous-toxin
5. SARS-CoV-2 Spike Protein Elicits Cell Signaling in Human Host Cells: Implications for Possible Consequences of COVID-19 Vaccines. Yuichiro J Suzuki 1 , Sergiy G Gychka. Vaccines (Basel). 2021 Jan 11;9(1):36. doi: 10.3390/vaccines9010036
6. https://news.northeastern.edu/2021/02/08/covid-19-can-affect-the-blood-its-spike-protein-may-be-the-culprit/
Biological and Clinical Consequences of Integrin Binding via a Rogue RGD Motif in the SARS CoV-2 Spike Protein. by Lee Makowski, William Olson-Sidford and John W. Weisel. Viruses 2021, 13(2), 146; https://doi.org/10.3390/v13020146
7. COVID-19 Coronavirus spike protein analysis for synthetic vaccines, a peptidomimetic antagonist, and therapeutic drugs, and analysis of a proposed achilles’ heel conserved region to minimize probability of escape mutations and drug resistance. by B. Robson. Comput Biol Med. 2020 Jun; 121: 103749.
8. Molecular mimicry between SARS-CoV-2 spike glycoproteinand mammalian proteomes: implications for the vaccine. Darja Kanduc and Yehuda Shoenfeld. Immunologic Research (2020) 68:310 –313.
9. Reducing Ribosome Biosynthesis promotes Translation during low Mg+2 stress. M.H. Pontes et al. 2016 Cell 64, 480-492.
10. Extracellular ATP and adenosine: The Yin and Yang of immune responses? M.M.Faas et al. Mol. Aspects. Med. 2017, 55:9-19.