mejbcart’s Newsletter

Share this post

User's avatar
mejbcart’s Newsletter
The rise of Adrenochrome and the fall of the Oxytocin, not only among the rulers.. Any SARS-CoV-2 Spike connection?

The rise of Adrenochrome and the fall of the Oxytocin, not only among the rulers.. Any SARS-CoV-2 Spike connection?

mejbcart's avatar
mejbcart
Dec 18, 2023
13

Share this post

User's avatar
mejbcart’s Newsletter
The rise of Adrenochrome and the fall of the Oxytocin, not only among the rulers.. Any SARS-CoV-2 Spike connection?
15
Share

Update 1/25/2025: https://rumble.com/v6bs8ty-child-trafficking-horrors-former-cia-officer-along-with-eyewitness-testimon.html “CHILD TRAFFICKING HORRORS: Former CIA Officer along with eyewitness testimony confirms the horrors“

Update 1/19/2024: https://www.brighteon.com/4cdaa696-4098-41c5-9695-ab3fd28d780b “British MP Blows Whistle: 'My Colleagues Are Elite Pedophiles Who Drink Babies' Blood'“

Update 9/14/2024: True adrenochrome stories by a true hero Jim Caviezel at https://rumble.com/v2vgq3u-steve-bannons-warroom-a-sit-down-with-jim-caviezel-full-interview.html

Update 9/3/2024: Ukraine ‘business’ “Adrenochrome Taskforce Rescues Hundreds of Kids Trafficked by Marina Abramovic” at https://rumble.com/v5dh9gt-adrenochrome-taskforce-rescues-hundreds-of-kids-trafficked-by-marina-abramo.html

Update 3/1/2024: Dr. Nehls in a discussion with Mike Adams, explains many things regarding neurogenesis and why the great die off during ‘covid protocols’: https://www.brighteon.com/c2491ae2-4a28-4e74-97a5-d94894a3f56f

“Dr. Michael Nehls, author of The Indoctrinated Brain, reveals terrifying blueprint for the globalist assault on your neurology”.

Update 1/3/2024: Added info on hepcidin drug produced by company financed by Len Blavatnik, an Ukrainian-born British-American billionaire, who Nov 2018 donated ~200mln$ to HMS https://news.harvard.edu/gazette/story/2018/11/a-gift-to-harvard-to-turn-medical-discoveries-into-treatments/ , for enormous opportunity for medical science from organ transplants to polio vaccines to gene therapy! That must have been an inside trader move, just on time, for the covid19 gene based injections, with now the same man harvesting on the side effects of these genetic modifications of suffering humans!!!

Update 12/18/2023: Please read all the way to the end and start thinking about the consequences of the presented analysis. Any critical views here are welcome.. It is about rescuing our world, expressed in different language, by this piece of music, before going into the real post below the video:


Dr. David Martin in his Oct 2023 talk at https://www.bitchute.com/video/MMXfRHgFybqK/

points to a Sep 2019 document at: https://www.gpmb.org/reports/m/item/2019-a-world-at-risk

Thanks for reading mejbcart’s Newsletter! Subscribe for free to receive new posts and support my work.

in which the ‘Global Preparedness Monitoring Board’ in its Progress indicator(s) planned by September 2020 (page 8) for:

“WHO and its Member States develop options for standard procedures and timelines for sharing of sequence data, specimens, and medical countermeasures for pathogens other than influenza.” Also: “Distributed manufacturing of vaccines (including nucleic acid types) begins within days of obtaining the new sequences and effective vaccines are pre-tested and approved for use within weeks.“ And lastly: ”Finally, we are grateful for the financial support provided to the GPMB Secretariat from the Government of Germany, the Bill and Melinda Gates Foundation, the Wellcome Trust, and Resolve to Save Lives.”

The most recent CHD Dec 10th 2023 interview of a Kaiser Permanente(KP) nurse at: https://childrenshealthdefense.org/defender/gail-macrae-california-icu-nurse-covid-protocols-vaccine-injuries/

and the same nurse Gail Macrae, in another interview by Steve Kirsch at:

Steve Kirsch's newsletter
The single most important interview I've ever done: former Kaiser nurse Gail Macrae
Executive summary My interview with former Kaiser Permanente Santa Rosa nurse Gail Macrae is the single most devastating interview I’ve done since I first started speaking out against the COVID vaccine in May 2021. Key points of the interview include…
Read more
2 years ago · 321 likes · 143 comments · Steve Kirsch

exposes covid crimes, lies about the 2020 ‘emergency’, about the covid protocols, NOT allowed reporting of injuries after the covid injections, EPIC computer system set up exactly in a way to never give any statistics about side effects in the covid injected victims, etc, etc.. It is shocking to listen to what the hospital staff and administration in this >1.5 year of her work was and still is capable of. KP is one of the largest (and cheapest) health care providers in CA, including their entire system of hospitals and research facilities, which follow the health progress of every member from begin to an end, and sometimes beyond (by inspecting the dead bodies). A publication titled: “Surveillance for Adverse Events After COVID-19 mRNA Vaccination” (https://pubmed.ncbi.nlm.nih.gov/34477808/) in which multiple KP facilities contributed to that overall ‘safety profile’ under the direction of CDC’s coworkers, including Tom T Shimabukuro, would need to be completely questioned, given the testimony of this witness. Given my own family experience, and now these testimonies, one can say with 100% certainty, ALL of the publications claiming safety of gene therapies are flat out LIES! That publication is just one out of many covid injection ‘safety’ studies in which KP almost always participates, using their own patients, with cases paid by the injection providers, like Pfizer. On the 12/14 another nurse came forward:

COVID Intel - by Dr.William Makis
VIDEO - ICU Nurse - what she witnessed in the ICU during COVID-19 pandemic, hospital protocols (Children's Health Defense) (Nov.19, 2023)
VIDEO - ICU Nurse (Children's Health Defense) (Nov.19, 2023…
Listen now
2 years ago · 94 likes · 39 comments · Dr. William Makis MD

with similar, ICU insider secrets. When you hear the words ‘they all died’ AFTER applying the ‘covid protocols’, any human heart should cry out loud. More of great nurses are coming with more truth about covid protocols, at the end of this post.

If there is one ingredient missing by everyone involved in the covid19 genocide, that would be the beauty/love/cuddle hormone, oxytocin. On the other hand, fear in a threatening situation (loss of job when trying to stand against criminal covid policies, in particular loss of a prestigious job and the ‘ego’ accompanied with it) where coercion plays a role, is connected with adrenaline, which when oxidized, produces adrenochrome, a superb free radical with cardiotoxic properties (https://pubmed.ncbi.nlm.nih.gov/11799843/). Studies in 50- and 60ies were reporting a connection between adrenochrome and thought disorder, derealization, and schizophrenia. The antidote to the toxicity of adrenochrome, was a superdose of Vit C and niacin (Vit B3) with other antioxidative nutrients, all described at http://orthomolecular.org/library/jom/1994/pdf/1994-v09n04-p205.pdf . National Institute of Health (NIMH) has been the leading critic and opponent to the adrenochrome hypothesis since 1954, and because of that, the adrenochrome hypothesis disappeared, together with the antidotes. This is a great pity, because oxytocin production is heavily dependent on the presence of the same compound, ascorbic acid (https://pubmed.ncbi.nlm.nih.gov/3668432/), and that in turn, does effect the outcome of covid19 disease, as we will see below. Try to ask for VitC injection in Kaiser Permanent-e facility, you won’t get it, ever. Parallel to this post, EXPOSE is publishing their article about adrenochrome topic too: https://expose-news.com/2023/12/13/the-truth-about-adrenochrome/ , with more references on it. It is worth checking out;)

The previous relaxin post (inspired by the Mod-E-RNA newest patents list) identified its connections to oxytocin, it also defined multiple probable nuclear localization signals in Spike sequence, next to the known furin site and pointed to its old homolog present in Non-Structural protein from 1918 H1N1 influenza virus.

Further bioinformatics of Spike sequence indicated that SARS-CoV-2 Spike ‘design’ intended its crossing of nuclear membrane in both directions. And this is the strangest thing with covid redefinitions and the illegal and thus criminal covid injections, the foreign objects now come not from the outside world causing immune response, the cause for apparent immunity comes now from inside, the human himself… Moderna new planned synthetic mod mRNA injection materials were discussed, in particular the relaxin, human hormone involved in pathophysiology of covid19, and also closely related to the mentioned for longest known human hormone, oxytocin with the amino acid sequence and the cyclic loop structure shown below: Cys – Tyr – Ile – Gln – Asn – Cys – Pro – Leu – Gly – NH2, or CYIQNCPLG-NH2..

So not only adrenochrome and oxytocin are effected by Vit C, but so is the IL-6 plasma level, one of the biggest markers of covid19 in high- and low-risk patients (https://www.sciencedirect.com/science/article/pii/S2667268521000358) and so is the CRP level, and the fasting blood glucose (FBG), all vitamin C dependent. The official daily dose of VitC of ~80mg/day, is 2x10 times lower than a study like this one: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4492638/, which suggests 2x~1000mg/day for the positive outcome in all the above mentioned markers. Dr. Paul E. Marik’s study, suggested even larger dose (6–24 g/day) of intravenous vitamin C to reduce mortality, intensive care unit (ICU) and hospital stays in case of sepsis and COVID-19 (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7762433/).

A 2010 study found an elevated IL-6 plasma levels under a psychological stress, with neurons of the hypothalamo-neurohypophyseal system (HNS) expressing not only IL-6 but also vasopressin while providing a neural link between stress and inflammatory responses (https://journals.physiology.org/doi/pdf/10.1152/ajpregu.00131.2010). Thousands of covid19 studies point to the involvement of IL-6 in this new condition (2 examples, https://pubmed.ncbi.nlm.nih.gov/37095536/, https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9727200/ ), including the long version of it. This publication (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2603556/) closes the oxytocin importance with one statement, quote: ‘oxytocin attenuates vascular oxidative stress and inflammation, two important pathophysiological processes in atherosclerosis.’ The positive oxytocin outcome was affecting the measured IL-6 secretion, indicating their mutual dependence in the inflammatory process.

An IL-6 specialist, the MIT researcher Rahul Kakkar, with history of biopharma experience (https://polarispartners.com/partner/rahul-kakkar/) is currently enjoying a CEO position at Tome Biosciences, whose technology, "represents the maturation of editing technologies, breaking current barriers in genomic medicines discovery": https://www.genomeweb.com/business-news/gene-editing-startup-tome-biosciences-launches-213m-financing

Here a statement of Mr. Kakkar :”"We can finally reprogram the human genome with an elegance and efficiency previously unimaginable.” The company employs John Finn, formerly of Intellia Therapeutics, and Matt Barrows, who led the scale-up for Moderna's COVID-19 mRNA vaccine. Other source mentions at https://www.biopharmadive.com/news/tome-biosciences-gene-editing-startup-programmable/702092/ the plan within the title “Tome Biosciences debuts with $213M and a new way to edit the genome“ (the human genome..). The plan is to use “programmable genomic integration,” or PGI, to “create gene therapies for liver disorders and cell therapies for autoimmune disease, ..” The Tomes Biosciences web page at: https://tome.bio/wp-content/uploads/2023/12/pr-2023-12-12_Tome-Biosciences-Launches-with-Over-200-Million-in-Funding.pdf discloses who pays and participates in this erasing procedure of the original human genome using insertions with the size of genetic code equal to the entire official size of the SARS-CoV-2 virus (~30 kb).

It is no surprise, that Mr. Kakkar owns quite few patents (https://patents.justia.com/inventor/rahul-kakkar) related exactly to what is troubling the covid injected victims:

METHODS FOR TREATING CARDIOVASCULAR DISEASE
METHODS FOR TREATING IL-6 MEDIATED INFLAMMATION WITHOUT IMMUNOSUPPRESSION
Treatment of existing left ventricular heart failure
METHODS FOR TREATING HEPCIDIN-MEDIATED DISORDERS

The last oldest of these patents (all after 2020) states, quote: “Typically, the patient has elevated pre-treatment serum levels of IL-6. In some embodiments, the patient has elevated pre-treatment serum levels of CRP.“ Well these are the plasma markers of covid19, among others. And what is the solution? A chemical factory, with countless IL-6 synthetic antagonists… Image below from https://www.universityofcalifornia.edu/news/blocking-love-hormone illustrates the strategy of the pharma based educational system taking over the most precious, the human heart:

In regard to IL-6 the post from 2022 at:

Where did the iron go*, the dopamine and uridine issue with SARS-CoV-2 toxic Spike protein and the mindless science, leading to more thoughts on 'Died Suddenly'. A link to Bing LIU?

mejbcart
·
December 7, 2022
Where did the iron go*, the dopamine and uridine issue with SARS-CoV-2 toxic Spike protein and the mindless science, leading to more thoughts on 'Died Suddenly'. A link to Bing LIU?

Update 6/25/2023: According to Dr. Tom Lewis, PhD, who with his experience of monitoring the labs during his own covid, found out that the ferritin(proliferates) / iron(suppressed) ratio is out of chart during the infection. His values were ~80, while cancer patients in a late stage can have values around 30-50.. Normal value of ferritin/iron ratio shou…

Read full story

was touching exactly the iron and liver/hepcidin issue. Kakkar’s last patent states that hepcidin expression is known to be influenced by the product of the TMPRSS6 gene, a matriptase-2, a type II transmembrane serine protease. All we know about covid is, that Transmembrane protease serine 2 , TMPRSS2 (https://www.uniprot.org/uniprotkb/O15393/entry) is involved but not TMPRSS6 (https://www.uniprot.org/uniprotkb/Q8IU80/entry). But these are both serine proteases with rather high sequence homology, yet one is only known to affect covid infection and the other is only known for influencing the iron absorption-regulating liver hormone hepicidin, which in turn is affected by IL-6. There is even a polymorphism involved, in which some people will have higher predisposition than others, to cardio diseases, for example (https://patents.justia.com/patent/20170029499). The uniprot entry details about these two serine proteases :

  1. for TMPRSS6 at https://www.uniprot.org/uniprotkb/Q8IU80/entry :

Cellular Component: extracellular space , plasma membrane

Molecular Function: metalloendopeptidase activity , serine-type endopeptidase activity

Biological Process: BMP signaling pathway , collagen catabolic process , extracellular matrix disassembly intracellular iron ion homeostasis , membrane protein proteolysis , multicellular organismal-level iron ion homeostasis , negative regulation of BMP signaling pathway , negative regulation of DNA-templated transcription , negative regulation of transcription by RNA polymerase II , positive regulation of transcription by RNA polymerase II , self proteolysis

  1. for TMPRSS2 at https://www.uniprot.org/uniprotkb/O15393/entry

Cellular Component: extracellular exosome , extracellular region , nucleoplasm , plasma membrane

Molecular Function: serine-type endopeptidase activity , serine-type peptidase activity

Biological Process: positive regulation of viral entry into host cell , protein autoprocessing , proteolysis , viral translation

Their transmembrane peptidase domains share ~40% identity over 250 residue section with LDL receptor domains sharing mainly the cysteine backbone pattern, for the 492 residues long TMPRSS2 and 811 residues long TMPRSS6. Despite of all these similarities the smaller TMPRSS2 (involved in Spike cleavage) interacts with 343 other proteins (https://thebiogrid.org/112968) and the much larger TMPRSS6, so important for iron homeostasis and DNA and RNA functions, interacts apparently with just TWO proteins (https://thebiogrid.org/127898). Hepcidin level modulation via inhibition of TMPRSS6, is equivalent with affecting iron levels, an issue in hematologic diseases. A company named Discmedicine https://www.discmedicine.com/our-pipeline/mat-2-inhibitor/ just got a fast-tracked FDA approval in Sep 2023 for that TMPRSS6 inhibition (via monoclonal antibodies) for polycythemia vera (PV), hereditary hemochromatosis, myelodysplastic syndromes (MDS) and β-thalassemia, all blood related. Is it strange that all these symptoms are also related with covid19, or let say, with the aftermath effects of the genetically modifying covid injections?? Isn’t it strange, that this company is financed by Len Blavatnik, the same who finances the MIT Blavatnik Institute, the home of Dr. George Church (the one also paid by Jeffrey Epstein), the super RNA-world geneticist, who oversaw the governmental covid19 operations?? Len is known for infinite amounts of money going to science, government, politics, it is as if Russia had the right hand in the heart of American science, Harvard, so it is no wonder one can see this kind of close cooperation:

:

Oxytocin/Vasopressin are parts of neurophysin I/II, which after proteolytic cleavage are released as hormonal neuropeptides, then binding to the G protein–coupled receptors (GPCRs), the oldest ‘attractive drug targets’ (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7439316/pdf/abb5419.pdf). Try to find which proteases cut these oldest known essential human hormones out of the neurophysins I/II, thus regulating their release and your life…. Good luck, it is hard to find. Even the WELCOME TRUST MEROPS data base (https://pubmed.ncbi.nlm.nih.gov/19892822/) recognizes the oxytocin sequence LTSA→CYIQNCPLG←GKR as a part of neurophysin, yet for the first cut it only says: XS26.001: signal peptidase complex (animal) and when you go to the link, you get serine type catalytic activity. For the PLG←GKR cut the ‘search retrieved no data’.. At least this MEROPS entry for the human gene 1p36, apparently deleted from the human genome as a ‘side effect’ by Pfizer BNT162B2 injections, connects some dots:

AA A28 A28.003 DNA-damage inducible protein 2 MER0030188 DDI2 84301 1p36.21

CA C19 C19.068 ubiquitin-specific peptidase 48 MER0064620 USP48 84196 1p36.12

CA C85 C85.003 OTUD3 peptidase (Homo sapiens) MER0122467 OTUD3 23252 1p36.13

CD C14 C14.010 caspase-9 MER0002707 CASP9 842 1p36.1-p36.3

MA M10 M10.022 matrix metallopeptidase-23B MER0004766 MMP23B 8510 1p36.3

MA M13 M13.002 endothelin-converting enzyme 1 MER0001057 ECE1 1889 1p36.1

MA M13 M13.008 neprilysin-2 MER0013406 MMEL1 79258 1p36

PA S1 S01.154 pancreatic endopeptidase E MER0000149 CELA3A 10136 1p36.12

PA S1 S01.155 pancreatic elastase II MER0000146 CELA2A 63036 1p36.21

PA S1 S01.157 chymotrypsin C MER0000761 CTRC 11330 1p36.21

PA S1 S01.205 pancreatic endopeptidase E form B MER0000150 CELA3B 23436 1p36.12

PA S1 S01.229 mannan-binding lectin-associated serine peptidase 2 MER0002758 MASP2 10747 1p36.3-p36.2

PA S1 S01.933 brain-rescue-factor-1 (Homo sapiens) MER0098873 MST1P9 11223 1p36.13

PC C56 C56.002 DJ-1 putative peptidase MER0003390 PARK7 11315 1p36.2-p36.3

SC S9 S09.025 lysophospholipase II (Homo sapiens) MER0209507 LYPLA2 11313 1p36.11

Part of the side effects’ list can be found at https://expose-news.com/2022/05/18/pfizer-guilty-committing-fraud-in-covid-vaccine-trials/). The above 1p36 deletions list points to one oxytocin related enzyme: Neprilysin, which according to wiki: “is a zinc-dependent metalloprotease that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin.[5] It also degrades the amyloid beta peptide whose abnormal folding and aggregation in neural tissue has been implicated as a cause of Alzheimer's disease.”

So now all that is gone, potentially… Also, please note the importance of all the essential human biomolecules, frequently given the names by the d-is-tin-guis-hed molecular biologists, ending with the word ‘SIN’.

Oxytocin results in more pro-social behavior, it also affects our memory and thinking (https://www.psychologytoday.com/us/blog/the-savvy-psychologist/202002/the-power-oxytocin ). Oxytocin with all its good features plays also a role in covid19, and the number of publications about it is growing:

  1. AM Barchi-Ferreira % FL Osorio “Associations between oxytocin and empathy in humans: A systematic literature review.” https://www.sciencedirect.com/science/article/abs/pii/S0306453021001426

  2. Keerthi Thirtamara Rajamani et al. “Oxytocin activity in the paraventricular and supramammillary nuclei of the hypothalamus is essential for social recognition memory in rats.” https://www.nature.com/articles/s41380-023-02336-0

  3. “Oxytocin as a Potential Adjuvant Against COVID-19 Infection

    Author(s):Pratibha Thakur*, Renu Shrivastava and Vinoy K. Shrivastava

    Volume 21, Issue 7, 2021, Published on: 10 September, 2020, https://pubmed.ncbi.nlm.nih.gov/32914732/

  4. “Oxytocin's anti-inflammatory and proimmune functions in COVID-19: a transcriptomic signature-based approach” Physiol Genomics. 2020 Sep 1;52(9):401-407. doi: 10.1152/physiolgenomics.00095.2020. Epub 2020 Aug 18.

    https://pubmed.ncbi.nlm.nih.gov/32809918/

  5. “Could oxytocin reduce autoimmune disease in COVID-19?“ Autoimmun Rev. 2022 Feb; 21(2): 102994. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8592845/

  6. “Potential of Endogenous Oxytocin in Endocrine Treatment and Prevention of COVID-19“ Front Endocrinol (Lausanne). 2022 May 3:13:799521. https://pubmed.ncbi.nlm.nih.gov/35592777/

  7. “Cardiovascular protective properties of oxytocin against COVID-19“ Life Sci. 2021 Apr 1:270:119130. https://pubmed.ncbi.nlm.nih.gov/33513400/

  8. “Oxytocin’s anti-inflammatory and proimmune functions in COVID-19:

    a transcriptomic signature-based approach“ Physiol Genomics 52: 401–407, 2020. https://journals.physiology.org/doi/pdf/10.1152/physiolgenomics.00095.2020

  9. “Hypothesis: Oxytocin is a direct COVID-19 antiviral” https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7528823/

  10. “Oxytocin, A Possible Treatment for Covid-19? Everything to Gain, Nothing to Lose“ https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8629037/

  11. “Endogenous Opiates: 1993“ https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7124241/pdf/main.pdf

Already in the 60’s there was enough indication, that RNA molecules participate in ‘transfer’ of memories:

  1. McConnell JV (1962) Memory transfer through cannibalism in planarians. J Neuropsychiatry 3 [Suppl 1]:S42.

  2. Albert DJ (1966) Memory in mammals: evidence for a system involving nuclear ribonucleic acid. Neuropsychologia 4:79 –92.

  3. McGaugh JL (1967) Analysis of memory transfer and enhancement. Proc Am Phil Soc 111:347–351.

  4. Luttges M, Johnson T, Buck C, Holland J, McGaugh J (1966) An examination of transfer of learning by nucleic acid. Science 151:834 –837.

  5. Jacobson AL, Babich FR, Bubash S, Jacobson A (1965) Differential approach tendencies produced by injection of RNA from trained rats. Science 150:636 –637.

Lack of consistent reproducibility, due to short life time of RNA, resulted in questioning this ‘memory theory’ for example in:

  1. Gross CG, Carey FM (1965) Transfer of learned response by RNA injection: failure of attempts to replicate. Science 150:1749.

But a recent study confirms that theory again:

  1. “RNA from Trained Aplysia Can Induce an Epigenetic Engram for Long-Term Sensitization in Untrained Aplysia.” May/June 2018, 5(3) e0038-18.2018 1–11 https://www.eneuro.org/content/eneuro/5/3/ENEURO.0038-18.2018.full.pdf

This topic is surfacing up again and again, also around 2001 (https://www.sciencedirect.com/science/article/abs/pii/S0166223600017392 ) which concluded, quote:”RNA-mediated modulation of neural function” and the possibility that “RNAi might be one of the physiologic mechanisms that regulate long-term gene expression in the brain.” or another conclusion “inhibitors of RNA and protein synthesis block formation of long-term memory when administered at the appropriate time (5,6)“.

Now let’s look at the by the SYNTHETIC mod mRNA expressed C-terminal Spike part, the most cysteine rich section of all and how these cysteines align with oxytocin CYIQNCPLG (https://www.ncbi.nlm.nih.gov/protein/NP_000906.1) or vasopressin Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly =CYFQNCPRG, with only the latter increasing blood pressure but not the former, a result of a difference of 2 amino acids, I→F and L→R:

       Sbjct  1  CYIQNCPLG  9  << oxytocin 1-9
                 CYGVSPTKLN    <<SPIKE 379-388
                 CYFPLQSYGF    <<SPIKE 488-497
                 CTMYICGDS     <<SPIKE

                 CYFPLQSYG     << SPIKE  488-496
       Sbjct  1  CYFQNCPRG  9  << vasopresSIN 1-9
       Sbjct  1  CYFQNC---PRG  << vasopresSIN 1-9
                 C    C    +G  <<Identities
             TIMLCCMTSCCSCLKGCCSCGSCCKFDEDD  << Spike 1231-1260
            TIMLCCMTSCCSCLKGCCSCGSCCKFDEDD  << Spike 1231-1260
     TIMLCCMTSCCSCLKGCCSCGSCCKFDEDD  << Spike 1231-1260
TIMLCCMTSCCSCLKGCCSCGSCCKFDEDD  << Spike 1231-1260

Oxytocin carrying neurophysin 1 protein also shows some homology with the C-terminal section of the universal poison called Spike:

     MAGPSLACCLLGLLA-LTSACYIQNCPLGGKRAAPDLD---VRKC neurophysin 1
     M    L CC     + L   C    C    K    + D   V K   
     MVTIML-CCMTSCCSCLKGCCSCGSCC---KF--DEDDSEPVLKG Spike
     M    L C       L   C    C    K    + D   V K
     MVTIMLCCMTSCCSCLKGCCSCGSCC---KF--DEDDSEPVLKG Spike

In case the body produces too little vasopres-sin a condition develops called diabetes insipidus (large urin production and thirst). One has to realize, that the dipeptide Tyr-Phe YF part of vasopresSIN is so important, that it can mitigate high-fat and high-fructose corn syrup diet-induced metabolic-associated fatty liver disease via upregulation of Nrf2/HO-1 expressions in C57BL/6J mice (https://www.sciencedirect.com/science/article/pii/S0753332223015226). And yet, the human body wastes FOUR of the Tyr-Phe (YF) dipeptides for every Spike protein synthesised after the Pfizer/Mod-E-RNA injection!!!

Since we got one integrated neuronal system in our human bodies, there is also a connection between oxytocin and and the small molecule adrenochrome:

just few publications and interesting links:

  1. “Effect of adrenalin and propranolol on progesterone and oxytocin secretion in vivo during the caprine estrous cycle“ The riogenology 1998 Mar;49(4):837-44.

    doi: 10.1016/S0093-691X(98)00033-8. https://pubmed.ncbi.nlm.nih.gov/10732092/

  2. “Effects of arterial infusions of adrenalin and acetylcholine on luteal secretion of progesterone and oxytocin in goats“ https://pubmed.ncbi.nlm.nih.gov/10734492/

  3. https://www.nienjabrouwer.nl/adrenalin-versus-oxytocin/

  4. https://www.drugs.com/drug-interactions/adrenalin-with-oxytocin-989-4184-1777-0.html

  5. “Inhibitory effect of adrenaline on oxytocin release in the ewe during the milk-ejection reflex“ J Dairy Res. 1979 Jan;46(1):41-6. https://pubmed.ncbi.nlm.nih.gov/438400/

Oxytocin became a frequent target in OPTOGENETICS, a method of remote controlled expression of chosen proteins. Few examples of those reports:

  1. “Wireless Optogenetic Stimulation of Oxytocin Neurons in a Semi-natural Setup Dynamically Elevates Both Pro-social and Agonistic Behaviors.” Neuron. 2020 Aug 19;107(4):644-655.e7 https://www.cell.com/neuron/pdfExtended/S0896-6273(20)30397-4

What’s the frequency of the stimulation? The citation from the above points to very low frequencies:

  1. Dine J., Genewsky A., Hladky F., Wotjak C.T., Deussing J.M., Zieglgänsberger W., Chen A., Eder M. Local optogenetic induction of fast (20–40 Hz) pyramidal-interneuron network Oscillations in the in vitro and in vivo CA1 hippocampus: Modulation by CRF and enforcement of perirhinal theta activity. Front. Cell. Neurosci. 2016;10:1–11.

Recently a viral gene delivery in oxytocin neurons of rats was used to monitor the oxytoxin production:

  1. STAR Protoc. 2021 Dec 14;3(1):101032. doi: 10.1016/j.xpro.2021.101032. “Viral vectors for opto-electrode recording and photometry-based imaging of oxytocin neurons in anesthetized and socially interacting rats“ https://pubmed.ncbi.nlm.nih.gov/34977678/

To control the oxytocin peptide levels with high spatiotemporal precision in vivo, a new method was just recently introduced, without application of gene manipulations, or viral expression vectors. Replacing just the TWO amino acids in the oxytocin, the first Cys and the following Tyrosin with photo-caged unnatural amino acids will impede cyclization through disulfide formation and get activated by UV light of 365 nm subsequently releasing the natural oxytocin while controlling its signalling and binding to its receptor.

  1. “Optopharmacological tools for precise spatiotemporal control of oxytocin signaling in the central nervous system and periphery”. https://ncbi.nlm.nih.gov/pmc/articles/PMC10081362/

The field of Optogenetics on many top universities in particular the Weizmann Institute established in 1934 by Chaim Azriel Weizmann, a Russian-born biochemist, Zionist leader and Israeli statesman who served as president of the Zionist Organization and later as the first president of Israel, couldn’t thrive better, without the proper funding (https://en.wikipedia.org/wiki/Chaim_Weizmann). Studies on plain illumination of presynaptic neuronal tissues were known to silence the neurotraansmitter release via the optogenetic silencing (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7611984/pdf/EMS138041.pdf). An extensive data base of human genes, including the one for oxytocin, can be found at: https://www.genecards.org/cgi-bin/carddisp.pl?gene=OXT.

With the details about the receptors binding the neuropeptides of interest here:

https://www.uniprot.org/uniprotkb/P30559/entry. Oxytocin receptor Gene OXTR

https://www.uniprot.org/uniprotkb/P37288/entry. Vasopressin V1a receptor AVPR1A

one could ask, if oxytocin is good against covid, according to check of ~2700 compounds tested for inhibition of Spike-Ace2 interface formation (https://pubmed.ncbi.nlm.nih.gov/34194331/), how about the sequence similarity of the oxytocin receptor and Spike? Here BLAST result showing ~80% sequence coverge with ~40% sequence identities assuming coverage by smaller fragments:

Query  297   VLAFIVCWTPFFFVQM-WSVWDAN-APKEASAFIIVMLLASLNSCCN  325
             +    +     + + + W +W    A+  A  ++ ++L  +  SCC
Sbjct  1214  IDLQELGKYEQY-IKWPWYIWLGFIAGLIAIVMVTIML-CCMTSCCS  1242
Query  292  FIIVLAFIVCWTPFFFVQMWSVWDANAPKEASAFIIVMLLA  319
            ++   A     +PF   QM   ++     +   +    L+A
Sbjct  898  WTF-GAGAALQIPF-AMQMAYRFNGIGVTQNVLYENQKLIA  925
Query  219  CYGLISFKIWQN-LRLKTAAAAAA------EAPEGAAAGDGGRVA  256
            CYG+   K+  N L   T   A +      E    A  G  G++A
Sbjct  379  CYGVSPTKL--NDLCF-TNVYADSFVIRGDEVRQIA-PGQTGKIA  419
Query  124  FASTYLLLLMSLDRCLA  140
            FAS Y      +  C+A
Sbjct  347  FASVYAWNRKRISNCVA  363
Query  122  GMFASTYLLLLMSLDRCLA---ICQPLRS  147
            G+    Y ++++S +   A   +C P +S
Sbjct  502  GVGYQPYRVVVLSFELLHAPATVCGPKKS  530
Query  297   WSVWDANAPKEASAFIIVMLLASLNSCCN  325
             W +W        +  ++ ++L  + SCC+
Sbjct  1214  WYIWLGFIAGLIAIVMVTIMLCCMTSCCS  1242
Query  195   WGPKAYITWITLAVYIVPVIVLAAC  219
             W    ++ +I   + IV V ++  C
Sbjct  1212  WPWYIWLGFIAGLIAIVMVTIMLCC  1236
Query  326   PW-IYMLF-TGHLFHELVQRFLCCSAS  350
             PW I++ F  G +   +V   LCC  S
Sbjct  1213  PWYIWLGFIAGLIAIVMVTIMLCCMTS  1239
Query  171   QVHIFSLREVADGVFDCWAVFIQPWGPKAYITW  203
             Q  I  L EVA  + +    + +    + YI W
Sbjct  1180  QKEIDRLNEVAKNLNESLIDLQELGKYEQYIKW  1212
Query  311  FIIVMLLASLNSCC  324
            F+ ++LL  ++S C
Sbjct  2    FVFLVLLPLVSSQC  15
Query  157  VLATWLGCLVASAPQVHIFSLREVADGVFDCWAVFIQPWGPK  198
            V+ T  GCL+  A +V+     ++  G   C +   Q   P+
Sbjct  642  VFQTRAGCLIG-AEHVNNSYECDIPIGAGICASYQTQTNSPR  682
Query  290  PFFFVQMW  297 OXTR, F291 and F292 bind to OXYTOCIN!!!
            PFF    W
Sbjct  57   PFFSNVTW  64  Spike
Query  59  CVLLALRT  66
           CV L  RT
Sbjct  15  CVNLTTRT  22
Query  235  TAAAAA  240
            TA AAA
Sbjct  259  TAGAAA  264
Query  321  NSCCNPWIYM-LFTGHLFH-ELVQRFLCCSASYLK-GRRLGETSAS  363
            N C N + +  L TG     E   +FL     +   GR + +T+ +
Sbjct  536  NKCVN-FNFNGL-TGTGVLTESNKKFL----PFQQFGRDIADTTDA  575
Query  171   QVHIFSLREVADGVFDCWAVFIQPWGPKA--YITW  203
             Q  I  L EVA ++ +   + +Q  G K   YI W
Sbjct  1180  QKEIDRLNEVAKNLNESL-IDLQELG-KYEQYIKW  1212

ACE2 binding Spike fragment aligns with OTX too:

Query  70   KHS---RLFF---------FMKH-------LSIADLVVAV-FQ---VLPQLLWD  100
            K+S    L F         F K        ++  DL+ A  F+   VLP LL D
Sbjct  814  KRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTD  867

Detailed interaction motifs of OTR (oxytocin receptor) and OT (oxytocin) at https://www.nature.com/articles/s41467-022-31325-0 describes the ‘PFFF’ motif as a part of the binding interface:

“OT interacts with residues F2916.51 and F2926.52 at the bottom of the binding pocket. This interaction induces a rearrangement of F2916.51, initiating the large outward movement of helix VI through a series of side-chain reorientations in conserved microswitches, including W2886.48 (CWxP motif), F2846.44 (PIF motif) and Y3297.53 (NPxxY motif) (Fig. 3c, d).”

That small part of the PFFF motif above was aligned with the Spike, here a try to expand it, by hand:

287 CWTPFFF-VQMWSVWDAN 297 OXTR
     + PFF  V ++ +
 54 LFLPFFSNVTWFHAIHV 70  Spike

    RTVKMTFIIVLAFIVCWTPFFFVQMWSVWDANAPKEASAFI  OXT receptor
    SVLHST--QDL-FL----PFFSNVTWFHAIHVSGTNGTKRFD  SPike 

and here the Trp-rich Spike section homolog with gp-160 in HIV:

    FIIVMLLASLNSCCNPWIYML-FTGHLFHELVQRFLCCS      OXT receptor
           KYEQYIKWPWYIWLGFIAGLIA-IVMVTIML       Spike

Now assuming Spike has a similar capability as the oxytocin receptor, while binding the oxytocin, what would be the result? It’s regulation, regulation of one of the most important human neurohormone involved in countless physiological pathways from birth to memory to love, and healing. Even without that speculative possibility, the drive of countless single amino acids by the new synthetic genetic code will affect the production of that simple cyclic peptide ‘CYIQNCPLG’ = ‘CxxxxCPLG‘ part of which, the ‘CxxxxC’, is patented by Fauci, for HIV treatment…

The recently deceased H. Kissinger apparently once said the following about GENETICS (2009 WHO council meeting) : https://www.brighteon.com/b220af6f-1a5f-466c-812f-70a88d71db16

“once the herd accepts mandatory magic potions it is game over. They will accept anything. Forcible blood or organ donation for the greater good. We can genetically modify children and sterilize them for the greater good. Control the sheep’s minds and you control the herd. Magic potion makers stand to make billions and many of you in this room are investors. It’ a big win-win. We thin up the earth and the herd pays us for extermination services.”

This text is available on youtube:

Since this statement had to be ‘fact-checked’:

https://www.politifact.com/factchecks/2019/jun/25/facebook-posts/henry-kissinger-never-said-once-herd-accepts-manda/

one can assume it was true and we are dealing with a total lack of EMPATHY here, something, what on a molecular level, is related to the missing OXYTOCIN. Many American presidents: https://www.kla.tv/index.php?a=showlanguage&lang=en&id=26158&date=2023-11-30 were seriously affected by it, including global world wide affairs... The tip of the covid crime was perpetuated by those, who forced GENE THERAPIES on clueless citizens, HUMANS:

https://forbiddenknowledgetv.net/pure-lies-pure-fraud-pure-evil/

This crime should never be forgotten.

On the other hand the adrenochrome issue intensifies:

https://www.brighteon.com/28203abb-5d44-4131-aaac-77daac14334c

Let’s hope people will come together, like in this little gathering just recently, and start telling the truth:

https://www.conservativewoman.co.uk/dr-david-martin-and-the-origins-of-the-coronavirus-plot/

https://expose-news.com/2023/12/16/doctor-exposes-the-biggest-hoax-in-medicine-outside-of-covid/

COVID Intel - by Dr.William Makis
VIDEO - Nurse Anesthetist (Christina Morris who now works for FLCCC) - what she witnessed (CHD Dec.15, 2023)
VIDEO - Nurse Anesthetist (Christina Morris who now works for FLCCC…
Listen now
2 years ago · 93 likes · 21 comments · Dr. William Makis MD

Thank you in advance for reading and comments.

Thanks for reading mejbcart’s Newsletter! Subscribe for free to receive new posts and support my work.

13

Share this post

User's avatar
mejbcart’s Newsletter
The rise of Adrenochrome and the fall of the Oxytocin, not only among the rulers.. Any SARS-CoV-2 Spike connection?
15
Share

Discussion about this post

User's avatar
kitten seeking answers's avatar
kitten seeking answers
Dec 18, 2023

what a nightmare, doc’s on adrenachrome… restacked nurse interview

Expand full comment
Reply
Share
1 reply by mejbcart
Gay Berg's avatar
Gay Berg
Dec 19, 2023

https://www.bing.com/search?q=oxytocin&form=ANNTH1&refig=af8c4ef06c814288a57f13ef5072ac2b&pc=SCOOBE&sp=1&lq=0&filters=ufn%3A%22Oxytocin%22+sid%3A%22d9b5df3f-f66a-4204-164c-4611f7b4b88c%22&asbe=LS&qs=MB&pq=oxytocin&sc=10-8&cvid=af8c4ef06c814288a57f13ef5072ac2b

Expand full comment
Reply
Share
13 more comments...

No posts

Ready for more?

© 2025 mejbcart
Privacy ∙ Terms ∙ Collection notice
Start writingGet the app
Substack is the home for great culture

Share