Where did the iron go*, the dopamine and uridine issue with SARS-CoV-2 toxic Spike protein and the mindless science, leading to more thoughts on 'Died Suddenly'. A link to Bing LIU?

Update 6/25/2023: According to Dr. Tom Lewis, PhD, who with his experience of monitoring the labs during his own covid, found out that the ferritin(proliferates) / iron(suppressed) ratio is out of chart during the infection. His values were ~80, while cancer patients in a late stage can have values around 30-50.. Normal value of ferritin/iron ratio should be ~1 (!!!!), or 0.65 being the most optimal. So why the human body puts all the iron for a storage and is not using it during that chronic anemia symptoms??? It is about oxygen availability.

Urgent update 14/12/2022: it is just a thought, but maybe a useful one, for all the injected victims, fighting neurological issues. Just please keep in mind this is just literature overview, not any medical advice…

Why was the original natural uridine substituted by a synthetic version of it in Pfizer/Mod-E-RNA covid injections, when human can’t metabolize that chemical?? Maybe because that’s the only base different between DNA and RNA, that uridine? Or maybe because those, who want to overwrite the nature and become their own proclaimed gods, claim RNA was first in their evolution speculations? What we know, without any speculations, is that the cytosol level of all NATURAL mRNA’s, which would not exist without URDIDINE, reflects the general overall health status… As a huge fan of natural supplements (after having to watch my fiancee die, because of medical malpractice, and finally ‘getting it’ after that personal tragedy) just found out that publication:”Potential Neuroregenerative and Neuroprotective Effects of Uridine/Choline-Enriched Multinutrient Dietary Intervention for Mild Cognitive Impairment: A Narrative Review”^17 and in particular that one “Uridine supplementation exerts anti-inflammatory and anti-fibrotic effects in an animal model of pulmonary fibrosis“^18 and this title alone “Uridine supplementation for the treatment of antiretroviral therapy-associated lipoatrophy: a randomized, double-blind, placebo-controlled trial“^19. Our bodies are walking wonders and were created to always know what to choose best, to heal. My hope is, the injected bodies will choose the NATURAL uridine, in particular since, quote^17:”In mild cognitive impairment (MCI) due to Alzheimer disease (AD), also known as prodromal AD, there is evidence for a pathologic shortage of uridine, choline, and docosahexaenoic acid [DHA]), which are key nutrients needed by the brain.” More on uridine at the end of this post.

---

The change in a title on the 12/8/2022 and on 12/14/2022 reflects few new thoughts, connected to the iron topic, and uridine. It is shortly discussed at the very end of this post. Also, this substack account is no more ‘electronically safe’, not receiving any updates any more, as if ‘somebody else’ owns it now!?? My experience with substack is getting worse with every day…

---

One of the most extensive atomic analysis done on the white rubber matter pulled by the embalmers from the deceased covid injected human bodies, was done by Mike Adams. His ICP-MS elemental analysis can be found at: https://www.naturalnews.com/2022-08-17-elemental-analysis-results-released-vaccine-clot-composition-not-blood-clots.html The newest analysis of the clot materials done by Dr. Cole in collaboration with German scientists claims no presence of graphene compounds. To show a noncalibrated MS spectra without MicroRaman analysis and to decide there is no rGO in the white rubbery clots, is not convincing to me, at all. Also to say any crystals are just salts is equally not a scientific method.

The by Mike presented IRON levels clearly indicated some kind of ‘iron imbalance’ in those victims. The official science by then was already full of ‘investigations’ around exactly that topic^1,2,3,4,5. The tip of the scientific blindness (or maybe evil arrogance?) represents the very in depth first paper from this list. It finds that a Hepcidin, a liver‐derived peptide hormone that is a crucial regulator of systemic iron homeostasis, is mimicked by the C-terminal portion of the Spike toxic protein, which they called COVIDIN. Here is their COVIDIN and Human Hepcidin ‘alignment’:

and here how I do it with the officially available NIH bioinformatics software BLAST:

26.9 bits(55) 7e-04 11/19(58%) 11/19(57%) 7/19(36%)

Query  69    CC----GCCHRSKCGMCCK  83
             CC    GCC  S CG CCK
Sbjct  1240  CCSCLKGCC--S-CGSCCK  1255
Query  26   VFPQQTGQLAELQ---PQDRAGARASW  49
            + P QTG++A+     P D  G   +W
Sbjct  410  IAPGQTGKIADYNYKLPDDFTGCVIAW  436
BLAST won't align the entire Hepcidin sequence (source at https://www.uniprot.org/uniprotkb/P81172/entry), so here doing it by hand, the first line is the Spike amino acid sequence (at https://www.ncbi.nlm.nih.gov/protein/1796318598), the second is the main circulating hormonal regulator of iron absorption and distribution across tissues:
                                   ^cut into the HIV-1 conserved portion
KEI-DRLNEVA-KNLNESLIDLQELGKYEQYIKWPWYIWLGFI-AGLIAIVMVTIML----------- 
  +   +   A   L   L+ L     + Q +     +      AG  A  M   M   <<<Identities
MALSSQI-WAACLLLLLLLASLTSGSVFPQQTGQLAELQ-PQDRAGARASWM--PMFQRRRRRDTHFP
and continued
CCMTSCCSCLKGCC--S-CGSCCKF  <<<< Toxic Spike2020
 C   CC    GCC  S CG CCK   <<<< IDENTITIES
IC-IFCC----GCCHRSKCGMCCKT  <<<< Hepcidin Liver Hormone

Just out of curiosity,here comparison to the transcriptional activator HIV-1 TAT protein
PQDRAGARASWM-PMFQRRRRRDTHFPICIFC-C-GCCHRSKCGMCCKT  <<<Hepcidin
PVDPRLE--PWKHPGSQPKTA-------CTNCYCKKCCFH--CQVCFITK <<<HIV1gp5

Please know, the C in the above alignment stands for cysteine, an amino acid participating in the 3 dimensional fold of every protein on this planet. Thus alone due to that fact, one can imagine the pieces which are having the cysteines aligned, will end up having very similar, if not identical fold/shape.

That paper defines ‘COVIDIN’: ‘WYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT‘, only as a part of Spike mimicking that most conserved part of Hepcidin sequence:

’MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT’

but as one can see above, the entire length of the liver hormone does show some conservative homology with the entire C-terminal portion of Spike, after swapping the little domains. When I first saw the Spike sequence early 2020, the most intriguing part of all was that CYSTEINE rich section, not present in any ‘normal’ protein, followed by that negatively charged string ‘DEDDSE’, which has the homology with the very short peptide sold as an antibody to the VMAT-2, the product of the so called GOD-gene… Equally interesting part of this is, that the begin ‘WYIW’ of the covidin is actually also the VERY conserved piece within the HIV-1 gp160 protein, having again homolog with glycoproteins of many other viruses:

How much HIV is in SARS-CoV-2? Fauci's 2018 patent, the NEW Synthetic SARS-CoV-2 Spike gene, with the OLD content.

The authors also mention that, quote: “This relationship of hepcidin and molecular mimicry of the SARS‐CoV‐2 Covidin peptide with host ferroportin may have significant ramifications on iron dysregulation and may be a key to understanding severe COVID‐19 human disease.”

And now the equally IMPORTANT sentence from that work leading to ‘Died Suddenly”: “Interestingly, the Covidin peptide was resistant to human proteolytic machinery suggesting persistence of this peptide postspike degradation in infected individuals and upon autophagy/apoptosis or necrotic degradation of dead infected cells with surplus unassembled viral proteins.“

Thus once again: viral SARS-CoV-2 toxic Spike C-terminal protein fragment mimics Hepcidin, which couples it to iron issues, but then this Spike part is also resistant to all common and major human proteases, thus not being able to be removed from the human body.

Do the authors, paid by Grant/Award Number: STARDOM award (#94551006 ), mention, that the gene, expressing trillions of those Spikes nucleotides (in MOD-E-RNA single injection with 100ug genetic material there are 6 200 000 000 000 nucleotides, https://molbiotools.com/dnacalculator.php ) that’s EXACTLY what is being injected in billions of arms??? NO, they describe it in context of virus features, discuss ‘vaccinations’ for all possible mutants, and the fact that the new variants are becoming alarmingly more resistant to selective human proteases associated with host defense!! Thus even MORE DEATHS after more injections with new ‘variants’! Why do not they mention that???

In terms of iron ‘disappearance, here their statement: “This functional spike‐derived peptide dubbed “Covidin”thus may be intricately involved with host ferroportin binding and internalization leading to dysregulated host iron metabolism.”

In nutshell, the COVIDIN, the most conserved SARS-CoV-2 Spike C-terminal portion (in every single coronavirus patent ever since ~2005, and completely identical in R. Baric’s coronavirus patent from 2015!!) is, quote: a potentiall allogenic mimetic hormone corresponding to severe COVID‐19 immunopathology, associated with severe disease status.
Thus by mimicking the HUMAN Hepcidin, the non-digestable Spike C-terminal fragment COVIDIN, according to their molecular modelling, will bind to ferritin, even stronger than Hepcidin does, leading to iron dysregulation. Iron trapped in the wrong time in enterocytes, macrophages, and hepatocytes, brain(!), instead of going into blood plasma, does lot of damage. This paper actually was submitted in Oct 2021, in time of full experience of what covid gene modification treatments with the Spike genome are doing to the human bodies. It was proceeded by a work from Australia, much earlier in Dec 2019, exactly on the same topic “Regulating the Hepcidin/Ferroportin Axis”^6, but of course, without mentioning SARS-CoV-2 yet…

We had SARS-CoV in the past, the mortality rates were much higher than SARS-CoV-2 at the very begin in 2002-2003, and yet, people were not dying on heart, myocarditis, stroke related issues, to my knowledge… The begin of the tragedy started with new gene therapies expressing the Spike INSIDE of the cells, totally opposite to what normal infection does, reacting to a pathogenic Spike coming from the other direction, outside of the cell.

For anyone in the regulatory field, just a single look at the list of KNOWN biological functions of Hepcidin, at the above mentioned uniprot link: https://www.uniprot.org/uniprotkb/P81172/entry

would and should be ENOUGH, to STOP ADMINISTERING covid injections containing the toxic Spike, bioweapon actually. The same stands for ACE2 receptor biological functions, with entire cascade of generated small peptides, among them neurotensin, all equally totally derailed by the Spikes, which are binding the ACE2 too. The list of those functions can be found at: https://www.uniprot.org/uniprotkb/Q9BYF1/entry

Thus trillions of SARS-CoV-2 synthetic Spikes do lot of damage…. How many more human proteins, RNA/DNA fragments are ending up binding the Spikes and their genes, interacting with them? This is a battle between PATENTED SYNTHETICS versus Nature, initiated by an illegal gene therapy inside of human bodies, without their consent.

In that respect a true revelation was published in 2021 and nobody was paying an attention to. That paper was titled ”SARS-CoV-2 Proteins Bind to Hemoglobin and Its Metabolites”^7 and it revealed that the Spike and couple of other of the SARS-CoV-2 virus proteins N, M, nsp3 and nsp7 all bind hemoglobin. Spike binds also hemoglobin metabolite hemin, and it does it via the same receptor binding domain RBD which docks to ACE2! The authors found six short sequences in the RBD and 11 in the NTD (N-terminal domain) of the spike, identified by microarray of peptides to interact with Hemoglobin(Hb). The brazilian authors also found that Hb, hemin, and PpIX (protoporphyrin) could block the SARS-CoV-2 virus adsorption and replication in vitro!! So again, here they find blood is essential in the viral infection process, publish it Aug 2021 and say no word about the very same Spike AND its genome, the same which binds that no1 blood ingredient, are being applied in every ‘covid vaccine’ out there!!! It looks like the patented Spike has every single portion of its genetic sequence planned for a LONG time. The c-term mimicks the hormone which drives iron the next biggest middle section binds hemoglobin and all of its metabolites, or ACE2, also related to every single blood issue within the human body.

What is left for the sick, uninformed citizen? Death by injection.

It is just unbelievable to even try to grasp the crime here.

The ACE2 receptor, binding the Spike from SARS-CoV-2 (or shall we say the design of the bioweapon was such, so it binds the ACE2 receptor, thus couples it to blood, to iron), normally has this physiological function:

angiotensin II + H2O = angiotensin-(1-7) + L-phenylalanine

so, does one need to wonder that publication like this appear: ”Dopamine Reduces SARS-CoV-2 Replication In Vitro through Downregulation of D2 Receptors and Upregulation of Type-I Interferons”^8 ??

Here is how phenylalanine is coupled with dopamine:

clearly the conversion of phenylalanine to the neurotransmitters, dopamine, norepinephrine, and epinephrine, will again, be affected by the supply of the buildibng blocks, single amino acids…

The lost Neurotransmitters caused by the Genetically Modifying Covid Injections, cancer and the pharma cartel.

What are the consequences of dopamine disregulations?

Here some citations:

-The role of dopamine and serotonin in suicidal behaviour and aggression^9

-Dopamine dysregulation syndrome in Parkinson's disease: a systematic review of published cases^10

-pleasure and motivation to motor control, ADHD, addiction, and schizophrenia ^11

Are iron and dopamine coupled in their physiological roles, if so, what are the consequences? Here are just few citations:

- Iron and dopamine: a toxic couple^12

-Brain iron and dopamine receptor function^13

-Iron, melanin and dopamine interaction: relevance to Parkinson's disease^14

Do we have side effects registered in VAERS, related to for example suicides? A search at https://medalerts.org/vaersdb/findfield.php as of 11/25/2022 reports:

“Found 16 cases where Vaccine is COVID19 and Symptom is Suicidal behaviour or Suicidal ideation or Suicide attempt or Suicide of relative or Suicide threat and Patient Died”

Just last note on that. In a small family, with 2 covid injected elders ~80, we have 2 deaths. One of it is suicide. Nobody wants to touch that topic, because older generation feels ashamed to talk about it. Autopsy results were kept by authorities. Nothing was ever entered into VAERS. How many more cases like that are out there? Just 16 cases among billions of injections, not included that one from that small family????? Here are few more todays’ examples of what else is happening after the covid injections:

VUPO

https://uncutnews.ch/schockierend-ubersterblichkeit-bei-millennials-lag-im-august-bei-36-etwas-schreckliches-ist-im-gange/

Looks like the ‘Died Suddenly’ was a report on only a very small begin. The lowered outer temperature in winter time is partly the player here, in my opinion.

And the last look at the entire HIV-1 TAT p14 transcriptional activator whose length is almost identical with hepcidin, just 2 amino acids difference, clearly shows remarkable common domains, just swapped, without any alignment:

1.MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQA
2.MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICI

1. SLSKQPTSQPRGDPTGPKE   <<<<HIV-1 TAT
2. FCCGCCHRSKCGMCCKT     <<<<Hepcidin

Maybe one day new grants will be given for new suggested drugs, this time using HIV-IN instead of COVID-IN.

In the meantime Dr. McCullough states, quote: “The arterial emboli take more explanation suggesting atherosclerotic plaque instability, platelet aggregation, and Spike protein driven hemagglutination, fibrin deposition, and progressive clot formation occur.  No matter what the sequence, in the setting of SARS-CoV-2 infection, blood clots can be attributed to Spike protein.“ Dr. McCullough substack is not allowing me now to post comments, without paying, after my first comment under his article was very critical, so I’m doing it here, for free.

I’d say to his above conclusion: The settings of SARS-CoV-2 are attributed to the Spike GENE, in particular the synthetic one, from the gene modifying injections, something what he is not willing to consistently change in his language! Why every MD is missing or better, not WANTING TO TALK ABOUT covid19 GENE THERAPY ?? Instead everyone is deceiving with the word ‘vaccine’, and it starts with CHD, HIGHWIRE, all anti-covid ‘vaccine’ activists.. It is so extremely deceiving. Because of that for 3 YEARS by now, the synthetic biotechnology is expanding to an unprecedented levels, all related to genetic modifications of the human genetic code. After the BIG 3h MEETING in DC organized by Senator Ron Johnson, covered here: https://rumble.com/v1zfa08-senator-ron-johnson-hosts-expert-forum-on-covid-vaccines.html

one of the participants, Del Bigtree posts on his Highwire today (12/8/22) a shorted version of that meeting, every single section talking about gene therapies was CUT OUT! Anyone wants to donate for ICAN? I’d beg people, give your money to those, who speak TRUTH, entire truth, and nothing BUT THE TRUTH. Today’s 12/12/2022 McCullough post titled “Pathological Syncytia Formation with mRNA Vaccines“ pointing to the just published article “Do Messenger RNA Vaccines Induce Pathological Syncytia?“ contains again a serious ‘error’ (have to ask, is it intentional or lack of knowledge?): the covid gene therapies carry synthetic genetic material, it is NOT mRNA, but rather mod mRNA, called also mmRNA, where uridine, the only base making a difference between DNA and RNA, statistically more prevalent in triples decoding aromatic amino acids, including the STOP codon, is substituted by N1-methyl-pseudouridine. We are dealing with synthetic genetics inside of human bodies, falsely called ‘vaccines’…

In the meantime, biotech, synthetic biology industry moves forward, as fast as they can, using HUMAN bodies as vessels for their patented technologies. Here the first example from todays news:”Researchers welcome $3.5-million haemophilia gene therapy — but questions remain” available at:

https://www.nature.com/articles/d41586-022-04327-7

with the picture described in that article as:”Haemophilia is a genetic condition that affects the formation of blood clots (pictured). Steve Gschmeissner/Science Photo Library”

Or today 12/12/2022, another announcement at https://www.newscientist.com/article/2350806-experimental-crispr-technique-has-promise-against-aggressive-leukaemia/ with that all telling quote:”A 13-year-old girl whose leukaemia had not responded to other treatments now has no detectable cancer cells after receiving a dose of immune cells that were genetically edited to attack the cancer”. The ‘Experimental CRISPR technique has promise against aggressive leukaemia’ after the experimental covid injections seems to fit, the planned scenario. Anyone more on the meaning of the number 13???

This post touches connection between the universally applied synthetic gene of Spike2020 and specific neurotransmitter, dopamine, and a very important liver hormone, Hepcidin. Is there a general connection between hormones and neurotransmitters?? Prof. Stanly B. Prusiner, the nobel prize winner for his work on prions, get’s into this topic in his old 1984(!?) paper little bit more: “Hormones and Neurotransmitters Control Cyclic AMP Metabolism in Choroid Plexus Epithelial Cells“^15. That’s about our ENERGY driving every single metabolic process in every cell of our so much still very UNKNOWN human bodies.

Thank you, my old good colleague, for sending me that paper!! Also, my deepest condolences for those affected by the TWO new sudden deaths in the Argonne Nationl Lab.

---

One of the last publications of the ‘suicidal’ scientist BING LIU from the University of Pittsburgh School of Medicine (5 May 2020 reports of his death) had a title: “Redox Lipid Reprogramming Commands Susceptibility of Macrophages and Microglia to Ferroptotic Death.“ Here I’ll just quote few sentences from the abstract of that work and from the article, all related to IRON:

-Ferroptotic death is the penalty for lost control over three processes – iron metabolism, lipid peroxidation and thiol regulation – common for pro-inflammatory environment where professional phagocytes fulfill their functions yet survive.

-intracellular availability of iron, controlled by transferrin receptors, is an important
ferroptosis regulating factor, particularly in macrophages

-Finally, we utilized a model of acute brain injury for which engagement of ferroptosis has been documented and in which the contusion environment with increased generation of ROS, lipid peroxidation and released hemoglobin represent a death threat to arriving macrophages and residential microglia.

-To examine the role of NO• in macrophage accumulation and loss after CCI (controlled cortical impact) we employed in situ magnetic resonance imaging protocols using paramagnetic iron oxide (MPIO) particles as described previously

-Life and biology of professional phagocytes (macrophages, microglial cells) is associated with perilous pro-oxidant environments, yet they are notoriously lacking from the lists of cells readily undergoing ferroptotic cell death. Given that their genomes contain sequences encoding for the known components of ferroptotic machinery we assumed that additional, yet to be identified mechanisms, may be responsible for the inability of phagocytes to execute the ferroptotic program, at least under some circumstances.

-Lipid peroxidation has been recognized as a fundamental part of ferroptosis.

-NO• has been suggested to act a pathophysiological modulator of cell proliferation, cell cycle arrest, and apoptosis.

-While we and others have shown that neuronal ferroptosis is important in mediating secondary injury after TBI, the contribution of ferroptotic death in other cell types to ferroptosis remains known. Given strong proinflammatory effects of ferroptotically dying cells, this information is important for designing optimized therapies for TBI.

-Our previous work has identified necroptotic death triggered by P. aeruginosa pLoxA as a contributing pathogenic factor in cystic fibrosis and lower respiratory infections. A recent work has implicated macrophage ferroptosis as a major mechanism of necrosis in Mycobacterium tuberculosis infection and as a target for host-directed therapy of tuberculosis. This may also relate to cancer where death of immunosuppressive M2-like macrophages in the tumor microenvironment may be a
desirable outcome in the complex immuno-therapy of cancer. In a number of neurological diseases, the precise timing for the activation of microglia and macrophages into pro- or anti-inflammatory states determines the overall outcome. Given strong pro-inflammatory effects of ferroptotically dying cells, the regulation of ferroptosis by iNOS/NO• may be important in controlling the inflammatory and immune responses.

RIP Bing Liu knew a LOT, and unfortunately is GONE. I’m learning a lot from him, right now, while reading his work. THANK YOU, wherever you are! Dr, Bryan Ardis connected Bing Liu’s death to his research related to venom peptides in one of his interview’s.

URIDINE issues:

A great summary of uridine importance in neurological processes can be found at:

https://smart-publications.com/articles/choline-uridine-builds-new-neurons-and-protect-against-Alzheimers/

Here a quote from that site:”Uridine’s conversion to CDP-choline in the brain makes additional choline available throughout the brain. So uridine doesn’t just build new neurons and repair damaged ones. It also acts as an additional source of choline throughout the brain.” The table 1 summarizes the most important so far known facts about uridine:

Table 1: Uridine’s Effects in the Brain

• Repairs and rebuilds neuronal membrane

• Enhances synthesis of synaptic brain proteins

• Increases production of neurites and dendrites

• Makes additional choline available through synthesis of CDP-choline

• Increases synthesis of ACh Increases levels of dopamine (neurotransmitter)

• Gets synthesized into PC via CDP-choline intermediary

That’s not all what uridine does, of course no life without it, but also the publication ^19 concludes, quote:”Conclusion: Uridine supplementation significantly and predominantly increased subcutaneous fat mass in lipoatrophic HIV-infected patients during unchanged HAART.” HAART (what a name..) stands for ‘Highly active antiretroviral therapy, which is associated with loss of subcutaneous fat (lipoatrophy) presumably due to mitochondrial toxicity of nucleoside reverse transcriptase inhibitors. Given how many similarities the synthetic Spike genome has with 2 major HIV-1 proteins, and how many remdesivir injured are out there, that conclusion might also make sense for the weight loss of many covid injected victims. Last but not least it appears, that uridine supplementation is equally important for the developing embryos^20. That study was performed on piglets though, and here a quote from the abstract:”Together, these results showed that maternal UR (uridine) supplementation could regulate placental nutrient transport, largely in response to an alteration of mTORC1–PPAR signalling, thus regulating the nutrition metabolism of neonatal piglets and improving reproductive performance.” A great overview about uridine supplementation affecting the dopamine receptors can also be found at: https://corpina.com/uridine-supplement-stacks-help-repair-dopamine-receptors/

Last but not least, since everything is connected, there is also connection between uridine and liver^21: “Uridine dynamic administration affects circadian variations in lipid metabolisms in the liver of high-fat-diet-fed mice“. In July 2022 a team of researchers from George Wahington Univeristy used an integrated approach while combining proteomics and metabolomics data and loking at the changes in metabolites and proteins in relation to covid19 patient characteristics^22. Their analysis, confirming that citrulline and uridine were severely depleted in the COVID-19 groups compared to the non-COVID-19 group, indicated also all the above in regard to uridine, in particular the anti-inflammatory and anti-fibrotic effects of that basic nucleoside. No real studies were done on it except for this computational investigation involving blood results of Covid19 patients with lowered uridine levels.

---

Also unfortunately editing substack is slowing my computer terribly, looks like it is NO MORE safe.

Literature.

1. Gupta Y, Maciorowski D, Medernach B, et al. Iron dysregulation in COVID‐19
   and reciprocal evolution of SARS‐CoV‐2: Natura nihil frustra facit. J Cell Biochem. 2022;123:601‐619. doi:10.1002/jcb.30207 https://pubmed.ncbi.nlm.nih.gov/34997606/

2. Zhou C, Chen Y, Ji Y, He X, Xue D. Increased serum levels of hepcidin and ferritin are associated with severity of COVID‐19. Med Sci Monit. 2020;26:e926178.

3. Taneri PE, Gómez‐Ochoa SA, Llanaj E, et al. Anemia and iron metabolism in COVID‐19: a systematic review and metaanalysis. Eur J Epidemiol. 2020;35(8):763‐773.

4. Banchini F, Cattaneo GM, Capelli P. Serum ferritin levels in inflammation: a retrospective comparative analysis between COVID‐19 and emergency surgical non‐COVID‐19 patients. World J Emerg Surg. 2021;16(1):1‐7.

5. Perricone C, Bartoloni E, Bursi R, et al. COVID‐19 as part of the hyperferritinemic syndromes: the role of iron depletion therapy. Immunol Res. 2020;68:1‐12.

6. Hawula ZJ, Wallace DF, Subramaniam VN, Rishi G. Therapeutic advances in regulating the hepcidin/ferroportin axis. Pharmaceuticals. 2019;12(4):170. doi:10.3390/ph12040170

7. Guilherme C. Lechuga et al. “SARS-CoV-2 Proteins Bind to Hemoglobin and Its Metabolites” Int. J. Mol. Sci. 2021, 22, 9035

8. Fiona Limanaqi et al. “Dopamine Reduces SARS-CoV-2 Replication In Vitro through Downregulation of D2 Receptors and Upregulation of Type-I Interferons” Cells 2022 May 19;11(10):1691.

9. Erik Ryding et al. “The role of dopamine and serotonin in suicidal behaviour and aggression.” Prog. Brain Res. 2008;172:307-15.

10. Nicola Warren et al. “Dopamine dysregulation syndrome in Parkinson's disease: a systematic review of published cases“ J Neurol Neurosurg Psychiatry. 2017 Dec;88(12):1060-1064.

11. https://www.brainfacts.org/brain-anatomy-and-function/genes-and-molecules/2020/dopamine-and-related-disorders-101220

12. Dominic J Hare, Kay L Double “Iron and dopamine: a toxic couple” Brain. 2016 Apr;139(Pt 4):1026-35.

13. M B Youdim et al. “Brain iron and dopamine receptor function” Adv Biochem Psychopharmacol. 1983;37:309-21.

14. D Ben-Shachar  1 , M B Youdim “Iron, melanin and dopamine interaction: relevance to Parkinson's disease“ Prog Neuropsychopharmacol Biol Psychiatry. 1993 Jan;17(1):139-50.

15. Richard B. Crook, Michael B . Farber, and Stanley B. Prusiner “Hormones and Neurotransmitters Control Cyclic AMP Metabolism in Choroid Plexus Epithelial Cells“ J . Neurochem.. V o l . 4 2 , N o . 2 , 1984.

16. Alexandr A. Kapralov et al. “Redox Lipid Reprogramming Commands Susceptibility of Macrophages and Microglia to Ferroptotic Death.“ Nat Chem Biol. 2020 March ; 16(3): 278–290.

17. Barry S Baumel et al. “Potential Neuroregenerative and Neuroprotective Effects of Uridine/Choline-Enriched Multinutrient Dietary Intervention for Mild Cognitive Impairment: A Narrative Review“ Neurol Ther. 2021 Jun;10(1):43-60. https://pubmed.ncbi.nlm.nih.gov/33368017/

18. Sanja Cicko et al. “Uridine supplementation exerts anti-inflammatory and anti-fibrotic effects in an animal model of pulmonary fibrosis“ Respir Res. 2015 Sep 15;16(1):105. https://pubmed.ncbi.nlm.nih.gov/26369416/

19. Jussi Sutinen et al. “Uridine supplementation for the treatment of antiretroviral therapy-associated lipoatrophy: a randomized, double-blind, placebo-controlled trial“ Antivir Ther. 2007;12(1):97-105. https://pubmed.ncbi.nlm.nih.gov/17503753/

20. Lu-min Gao et al. “Maternal supplementation with uridine influences fatty acid and amino acid constituents of offspring in a sow–piglet model“ British Journal of Nutrition , Volume 125 , Issue 7 , 14 April 2021 , pp. 743 - 756 https://www.cambridge.org/core/journals/british-journal-of-nutrition/article/maternal-supplementation-with-uridine-influences-fatty-acid-and-amino-acid-constituents-of-offspring-in-a-sowpiglet-model/72AA82ABAD621FFE81EC62D32AD2913A

21. Yilin Liu et al. “Uridine dynamic administration affects circadian variations in lipid metabolisms in the liver of high-fat-diet-fed mice“ Chronobiol Int. 2019 Sep;36(9):1258-1267. https://pubmed.ncbi.nlm.nih.gov/31296061/

22. Ali Rahnavad et al. “Metabolite, protein, and tissue dysfunction associated with COVID-19 disease severity“ Scientific Reports volume 12, Article number: 12204 (2022) https://www.nature.com/articles/s41598-022-16396-9

    ---

    *’Where did the (X) go' is borrowed from the title of an amazingly important book by Prof. Judy Wood “Where Did the Towers Go? Evidence of Directed Free-energy Technology on 9/11“ It is a book for anyone, but in particular for physicists who stayed blind to the very obvious facts about the physics which happened on 9/11.