Update: 1/29/2024 The title “Cell-free DNA and RNA—measurement and applications in clinical diagnostics with focus on metabolic disorders” in Physiol Genomics 53: 33–46, 2021, implies, to what extend the medial cartel planned their future, while forcing the genetically modifying covid injections on billions of clueless citizens, ever since the end of 2020, the begin of that universal therapy, which started with changing the RNA pools of the human genome. The medical genocide goes that far, that SATNFORD, sorry Stanford, publishes proudly an article titled ‘The beat goes on’, in which since 2022 cardiothoracic surgeries are being performed with still beating hearts form cardiac arrest patients (the ones caused by the covid injections?) with astonishing success!!! A new field of ‘morpholome’ was invented, also in Satnford, sorry, stanford, which refers to variety of cell shapes taken on by an organism. Euan Ashley, Maddison Masaeli and Mahyar Salek (google AI expert) while analyzing the HEART CELL MORPHOLOME, want to differentiate deceased cells from others that have been ‘cured’(????) by gene-editing technology (Stanford Medicine, Issue 3, 2023). Between Apr 2023 and the print out date of that Stanford magazine (begin of ‘24), the amount of this sort of heart transplants, more than DOUBLED (https://med.stanford.edu/news/all-news/2023/04/beating-heart-transplant.html)
Another Stanford hero, https://profiles.stanford.edu/michael-ma, published in ‘22 statistics on infants heart transplants, https://pubmed.ncbi.nlm.nih.gov/35835207/, strangely covering the years 1994 to Sep 2019, and avoiding anything AFTER 2020 (WHY????), together 2552 infant heart transplants reported to UNOS.. If there is anyone who could help the embalmers to decipher the terrible clot issues, it would be this person specializing on multilevel obstruction of systemic and pulmonic arterial systems… Straight from Chemical Engineering to medicine, what an ideal transformation, unfortunately with ZERO input for the embalmers struggling with dead bodies of covid injected victims!!!
The main post is behind the divider bar below. THANK You for reading and SHARING.
Who took over our world, made of genes, by Patrick Wood, incredibly good talk: https://rumble.com/v2dhgmh-the-evil-twins-of-technocracy-and-transhumanism-patrick-wood.html
How many educated people, the young ones in particular, do know what ‘genomic medicine’ is? The annual 42nd JP Morgan Healthcare Conference in San Francisco this year https://www.genomeweb.com/business-news/jp-morgan-healthcare-conference-day-1-bruker-exact-sciences-qiagen-neogenomics indicates an industrial trend shift of some of the big companies. For example Brucker; its CEO defines the era we live now, as ‘postgenomic era’, here his quote:
"The last 20 years were dominated by genomics," he said. "But proteomics and related fields like glycomics, lipidomics, metabolomics, epiproteomics … is going to be at least equally important as genomic medicine, and in many areas will be able to go far beyond what genomic medicine was able to do."
Truly stunning, because once again, how many people know that we got the ‘genomic medicine’ for 20 years already? Some call it ‘precision medicine’, but why precision? To cover up the involvement of every 100% INDIVIDUAL, personal GENE? Bret Weinstein and all MD’s on sub-stack until this very day have extreme difficulties to even mention GENE THERAPY consistently when talking about covid injections, including the alternative ‘officially punished’ MD’s. On the other hand, substack writer Eric Topol (erictopol.substack.com), the notorious NIH award recipient, first in 2016 for US$207 million for the Precision Medicine Initiative, and then just recently renewed for further $282 million over five years, and that in addition to Clinical and Translational Science Awards (CTSA) who threw into the basket another $46.8 million for 7 years, mainly writes about genes and their applications, but is seldom combining it with the word ‘vaccines’ or gene therapies in case of covid19 injections. The newsletter Ground Truths has the same loopholes as all the posts of the alternative good MD’s, unfortunately, the truths are missing. There are many more ‘truths’ here on sub-stack, for example ‘Unreported Truths’, equally filled with PART-truths completely missing the essence, or straight misinforming, again.. It looks like if you have a family member working for the establishment, for example the medical cartel, you do not won’t to get into a ‘bad spotlight’, including NOT ALLOWING to comment under own posts, here on this ‘liberal’ platform.
So the NIH page at https://www.genome.gov/health/Genomics-and-Medicine/accomplishments, lists accomplishments of that ‘genomic medicine’ discipline all the way back to 2011, with posted reviews/publications for each year between 2011-2023. So there is about one decade of information missing, but nevertheless very much worth browsing and looking at some of them, at least...
The very first registered Jan 2011 publication comes from Welcome Trust with the title “Massive genomic rearrangement acquired in a single catastrophic event during cancer development”^1. It almost sounds like the 2020 catastrophic PLANdemic with exactly the very frequent issue of covid19 injected individuals who are fighting with horrifying cancers, right now.
The very first entry in Feb 2012 was titled “Truncations of Titin Causing Dilated Cardiomyopathy“ (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3660031/#SD1).
BLAST comparison of that largest muscle protein titin with SARS-CoV-2 Spike (done already in 2022 in my older posts), results in thousands of fragments with very high homologies to the Spike, clearly indicating disturbances of the natural production of titin during the same time of the Spike production, not even talking about the mutual interactions of all these products. Table 14 summarizes mutations within titin which correlate with specific human diseases. Here the amino acid section similar in titin (query line) (https://www.uniprot.org/uniprotkb/Q8WZ42/entry) and Spike (Sbjc line), with the lysine 33915 whose mutation is involved in Congenital Myopathy, according to that 2012 publication:
Query 966 LSSNFGAISSVLNDILSRLDKVEAE---VQIDRLITGRLQS LQTYVTQQLIRAAEIRAS
+ ++ G++SS + + EA+ Q IT + ++ +Q ++Q+ +R+ EI+ S
Sbjc 33853 VKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMS
Query1022 ANLAATKMS 1030 human titin
+ K++
Sbjc 33913 EAKSQEKLA 33921 SARS-CoV-2 Spike
K33915<<= mutation causing the myopathy
to produce that section of titin, one needs 7 positively charged amino acids (R,K), to produce this Spike section requires 13 of those, in the same time!
Lets take more series of the NIH ‘Genomic medicine’ program, for example publication from Aug 2012 Vemurafenib: a new treatment for BRAF-V600 mutated advanced melanoma seems to be applicable to covid19 in 2020 too, according to https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9114699, quote “the findings suggest that vemurafenib can be used for the treatment of COVID-19 (84).“
July 03, 2014 - Loss-of-function Mutations in APOC3, Triglycerides and Coronary Disease by Broad Institute (BI at MIT), with George Church^1, the covid19 national response co-coordinator, being also part of that genomes super sequencing center. This is a BLAST output on APOC3 (one of many) special section, covering BOTH mentioned mutations R19 and A43:
* rarely mutated residues causing lower plasma triglyceride levels
* *
Query 13 ALLASARASE----AEDASL-LSF-MQGYM--KHATKTAKD 45 APOC3 human
ALLA + +S A A L + F MQ M +
Sbjct 876 ALLAGTITSGWTFGAGAA-LQIPFAMQ--MAYRFNGIGVTQ 913 Spike2020
and the above Spike 2020 amino acid sequence string, now in billions of human bodies, comes up, again and again, maybe because of the physical importance arranged below???
In the same year, the entry from Jul 2014 - Spread of Artemisinin Resistance in Plasmodium falciparum Malaria^2 is special, because it points to the perpetrators of covid19 single catastrophic event, and here they are, in acknowledgments:
Supported by grants from the U.K. Department for International Development, the Worldwide Antimalarial Resistance Network, the Intramural Research Program of the National Institute of Allergy and Infectious Diseases of the National Institutes of Health, and the Bill and Melinda Gates Foundation. The Mahidol-University Oxford Tropical Medicine Research Programme is funded by the Wellcome Trust of Great Britain.
It is about parasite P. falciparum’s (malaria agent) toxic protein known as kelch13 (https://www.uniprot.org/uniprotkb/Q8IDQ2/entry) and artemisinin-based remedies and the resistance to these drugs. For those who forgot :”Nobel prize for the artemisinin and ivermectin discoveries: a great boost towards elimination of the global infectious diseases of poverty”^2. And here a BLAST between Spike and the kelch13 protein, some of which are just stunning indeed:
Query 372 KDSFIEKLLSGRHHVTRDKQGRI 394 Kelch protein K13
K SFIE LL VT G I
Sbjct 814 KRSFIEDLLFNK--VTLADAGFI 834 Spike 2020
THE MOST known KRSFIEDL section of Spike, and more:
Query 438 KFLPFPLVF--CIGG-FDGVEYLNSMELLDISQ 467 Kelch protein K13
KFLPF F ++ D V ++E+LDI+
Sbjct 558 KFLPFQQ-FGRDIADTTDAVRDPQTLEILDITP 589
ACE2 binding domain:
Query 496 GGN-NYDYKALFE-TEV--YDRLRDV 517 Kelch protein K13
GGN NY Y+ LF + + ++ RD+
Sbjct 446 GGNYNYLYR-LFRKSNLKPFE--RDI 468 ACE2 RBD in Spike
the piece with C580Y mutation of Kelch13 (in pub)
*
Query 562 MKAWVEVAPLNTPRSSAMCVAFDNK-------IYVIGGTN 594 K13
V N A C D K ++V GT
Sbjct 1066 --TYVPAQEKNFTTAPAIC--HDGKAHFPREGVFVSNGTH 1101 Spike
It looks like the Spike, despite of having nothing to do with parasites must have some of its features somewhat similar to that parasitic protein Kelch13, to a level, where they both bind to the same drug, artemisin related ivermectin….. The Single Point Mutation C580Y is important, quote: In this large study, multiple kelch13 SNPs (single-nucleotide polymorphisms) were highly predictive of slow parasite clearance and were associated with more than double the parasite clearance half-life. Some SNPs (notably C580Y) predominated. The very controversial Spike and IVERMECTIN issue, ends in this article with one quote^4:”Our experimental data on the docking of ivermectin on SARS-CoV-2 spike protein (in native form) revealed a strong binding of the compound with an energy value of -261.74 and -287, respectively, for B1a and B1b homologs.” And the conclusion:”Our study enlightens the candidature of ivermectin as an effective drug for treating COVID-19.”
April 01, 2015 - “Cell-free DNA Analysis for Noninvasive Examination of Trisomy” publication is describing Down's syndrome detection based on cell-free DNA (cfDNA) fragments representing all or part of a third copy of chromosome 21. Just one question, what’s in that chromosome and how many similar/homologs of its fragments are inside of every vial of the covid19 gene based treatments contaminated with billions of cDNA fragments?
April 07, 2016 - Near real-time monitoring of HIV transmission hotspots from routine HIV genotyping: an implementation case study at https://www.thelancet.com/journals/lanhiv/article/PIIS2352-3018(16)00046-1/fulltext indicates, genotyping was done then and now even more so. Everyone knows the first Spike variant mutation D614G^5. Is that residue conserved in HIV gp160 protein, to which spike is so similar? Here the BLAST output of ~160 amino acid long continuous string, with Query being HIV gp-160, Sbjct the Spike, placing at the position of that aspartic acid (D) the ’ * ‘ sign:
Query 129 DLSTLRNATDNSSTTEGGEIKKCSFN----ITTSIKTKVKDYALFYKYDV------VQID
D++ +A + T E +I CSF IT + T A+ Y DV V I
Sbjct 568 DIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTS-NQVAVLYQ-DVNCTEVPVAIH
in LYQ>D<VN, the CONSERVED D614 in HIV and in the Spike>>>>*
Query 179 ND--TAKYRLINCNTSVI-TQACPKVSFEPIPIHYCAPAGFAILKCNDEKFNGAGKCKNV
D T +R+ + V T A + E + Y C+ GAG C
Sbjct 626 ADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSY---------ECDIPI--GAGICASY
Query 236 SAVQCT-HGIRPVVSTQLLLNG-SLAEEEVIIRSSNFTNNAKIIIVQLN--ESV 285
+ + + R V+S ++ SL E S ++NN+ I I N SV
Sbjct 675 QTQTNSPRRARSVASQSIIAYTMSLGAEN----SVAYSNNS-IAIPT-NFTISV 722
and using different BLAST search parameter: *
Query 377 NTTPLFSSIWNADGTWNGTTGGGNITLPCRIKQIVNMWQEV-----GKAMYAPPIEGQIR
+ TP + G + +T G N++ Q+ ++Q+V + A++A + R
Sbjct 586 DITPC------SFGGVSVITPGTNTS-----NQVAVLYQDVNCTEVPVAIHADQLTPTWR
Does this has anything to do with the long HIV-like covid19??? Dr. Fauci, please confirm, over. Oh, there is a memory blackout on the other side, right now. A substitution comes right on time with the title “NEW - Dr. Deborah Birx Says 'Long COVID' is Similar to HIV”:
https://twitter.com/thechiefnerd/status/1745568361537216766
Little more patience, few more years of genetic medicine, with continuously increasing number of publications, many mentioning LOSS OF FUNCTION in animals/humans being studied, and that, while the viruses seem to gain more and more of their functions...
May 24, 2017 - Genetic and Pharmacologic Inactivation of ANGPTL3 and Cardiovascular Disease (https://www.nejm.org/doi/full/10.1056/NEJMoa1701329)
So this study claims (nejm, be careful) when affecting the genes of angiopoietin-like 3 (ANGPTL3) and in ANGPTL4 via application of ANTI-sense oligonucleoties (mRNA, the real ones) the result in REDUCTION of production of those proteins (=LOSS OF FUNCTION), will change the plasma LDL cholesterol, high-density lipoprotein (HDL) cholesterol, and triglycerides. The study concludes: no serious adverse events, and how strange, exactly like in their published covid19 injections studies, the identical amount of controls and placebos, reported the same side effects, dizziness. No wonder, brain without cholesterol does not exist.
August 10, 2017 - Analysis of plasma Epstein-Barr virus DNA to screen for nasopharyngeal cancer (https://www.nejm.org/doi/full/10.1056/NEJMoa1701717)
Nejm again, this time saying EBV DNA in plasma specimens is a biomarker for nasopharyngeal carcinoma. The complete genome of EBV virus is at https://www.ncbi.nlm.nih.gov/nuccore/NC_007605.1 There is that one special nuclear antigen EBNA-LP protein code for YP_401636.1 of EBV virus with the following amino acid sequence, mentioned one of the first posts of mine:
>YP_401636.1 nuclear antigen EBNA-LP [Human gammaherpesvirus 4] MGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPLRPRPRPPARSLREWLLRIRDHFEPPTVTTQRQSVYIEEEEDED
do you see the six ‘RGD’ motifs, special hallmark of all integrins, including Spike? Do you see the seven ‘PRRVR’ motifs, homologs of furin ‘PRRAR’ sites, like the one in Spike? Do you recognize the SPSP motif, responsible for phosphorylation and possible role in cancer initiation or progression^6? That ‘RGD’ motif, also in Spike2020, these simple THREE AMINO ACIDS Arg-Gly-Asp, has to do with cancers. And it looks as if somebody programmed almost intentionally the killer series of ‘RGD's into EBV. The article “Every step of the way: integrins in cancer progression and metastasis“ at https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6629548/ describes more the details of the process. Why was the Spike designed with RGD motif, to disregulate all the others??
The genomic medicine in 2019 starts with the publication - Integrating Genomics into Healthcare: A Global Responsibility by Stark Z. (https://pubmed.ncbi.nlm.nih.gov/30609404/)
That publication summarizing who and how much was spend for the endeavor to hack the HUMAN GENOME ends with quote: “We have a global responsibility to accelerate the implementation of genomic medicine and enable the timely realization of the benefits of genomics for individual patients, families, and healthcare systems.”
At the end of 2019 MIT and its entire crew, which started the hacking in 2011, no must be much earlier than that(!) NIH page admits, knew already that “Rare Genetic Variants Associated with Sudden Cardiac Death in Adults“ are related with, for example the mentioned above gene encoding titin (TTN), with apolipoprotein B (APOB) and tyrosine-protein phosphatase (DSP2) ^7.
The science met the practice with the covid19 injections clinical studies in 2020 and the global injection campaign in 2021, until now, while slowly incorporating the health care providers into the genomic medicine, which ended with Aug ‘23 publication: “An Introductory Tutorial on Cardiovascular Pharmacogenetics for Healthcare Providers“ (https://pubmed.ncbi.nlm.nih.gov/37303270/).
The abstract ends with the positive view of the authors, quote “Ultimately, improved education among healthcare providers on cardiovascular pharmacogenetics will lead to a greater understanding for its potential in improving outcomes for a leading cause of morbidity and mortality.“ The choice on bold characters of the last sentence is mine.
Today the ‘health care’ professionals can get training in this new discipline, of which many still do not know, that it exists: https://www.genome.gov/careers-training/Modules-in-Genomic-Medicine-for-Healthcare-Professionals, and that only, because once again, ALL MD’s are silent about the covid genetically modifying injections and continue talking about ‘vaccines’. Sorry for repeating the same x^x^x-times, like MSM.
The most recent and last publication of NIH+Welcome Trust ‘genomic medicine’ is the first one mentioning the word CRISP:
”October 31, 2023 - CRISPR-Cas9 Editing of the HBG1 and HBG2 Promoters to Treat Sickle Cell Disease (https://pubmed.ncbi.nlm.nih.gov/37646679/)
Without any further analysis of the above, the last thing, today’s personal information status on covid19 genetically modifying injections: one family’s good friend died suddenly last week, one cousin got cancer, and had to undergo extensive surgery, after the 4th covid jab.
Who is going to help all the victims of misinformation? The now ‘genetic medicine’ trained MD’s, who won’t tell any patient that they got genetically modified because of their advice to get ‘vaccinated’??? Maybe that is part of the training, to keep it secret…
And the horror of synthetic biology grows exponentially with every day: https://dornsife.usc.edu/news/stories/synthetic-chromosomes-faster-cheaper/
rising completely out of proportions, while literally taking over in an absolute arrogant way the entire nature, laughing in the face of those who appreciate the real Creator, with their new “CReATiNG (Cloning Reprogramming and Assembling Tiled Natural Genomic DNA)“ synthetic nonsense.
How much the TOP American MD’s involved in covid injections ‘truth movement’, are INFLUENCED by the ‘genomic medicine’ can be clearly heard when listening to Dr. Cole in UK:
and NOW IN USA, (spare yourself of listening to Dr. McCullough…) just start at ~35:00 when Dr. Cole is speaking:
Literature.
Philip J Stephens “Massive genomic rearrangement acquired in a single catastrophic event during cancer development.“ Cell 2011 Jan 7;144(1):27-40. https://pubmed.ncbi.nlm.nih.gov/21215367/
https://biophysics.fas.harvard.edu/people/george-m-church also covered in
E. Tambo et al. “Nobel prize for the artemisinin and ivermectin discoveries: a great boost towards elimination of the global infectious diseases of poverty“ Infectious Diseases of Poverty volume 4, Article number: 58 (2015) https://idpjournal.biomedcentral.com/articles/10.1186/s40249-015-0091-8
Abhigyan Choudhury et al. “Exploring the binding efficacy of ivermectin against the key proteins of SARS-CoV-2 pathogenesis: an in silico approach” Future Virol. 2021 Mar : 10.2217/fvl-2020-0342. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7996102/
From gene therapy to genetic enhancement, from genetic enhancement to eugenics.
I don't believe in the success of deciphering the human genome, this will forever be a mystery, I think it's pure propaganda and speculation, they can brag as much as they want, they can write oceans of books and studies, judging by the mess we live in, it's obvious that science is not just that it has natural limits and imposed limits, but it is also ill-intentioned....but I believe that sick minds exist, as well as the power to do harm, to destroy, which is easier and more profitable than doing good and building.
Q. - Does natural infection with SARS COV2 cause these same cancer and cardiovascular problems? And if so do multiple infections compound the problems?