The main post starts behind the divider bar. First few newer updates, post related.
11/21/2022: Stew Peters new documentary ‘DIED SUDDENLY’ available at: https://www.stewpeters.com/video/2022/11/world-premier-died-suddenly/ shows the entire truth which DOES NOT need any ‘scientific studies’ any more. The covid injections genocide has to be STOPPED NOW.
11/21/2022: New Report about suddenly dying medical doctors in Canada: https://uncutnews.ch/aerzte-die-nach-der-covidimpfung-gestorben-sind-naehert-sich-der-100-ausserordentlich-alarmierend/
11/10/2022: “In a World First, Two People Received Transfusions of Lab-Grown Blood” https://singularityhub.com/2022/11/10/in-a-world-first-two-people-received-transfusions-of-lab-grown-blood/ Looks like the ussual strategy, first ruin HUMAN blood, THEN offer the ‘replacement’. The same was done with our FOOD, remember?
11/4/2022: The deaths in sleep, where the body is positioned horizontally, in darkness, was just recently explained by Dr. Peter McCullough (who developed a great formula to strengthen heart muscles with lot of nutrients and D-ribose, RNA component, used by many pilots for a LONG time) at: https://www.thegatewaypundit.com/2022/11/dr-peter-mccullough-really-happening-people-die-sleep/ involves Catecholamines, described in my previous posts:
Also a newest report of officially recorded ‘sudden deaths’ can be found at: https://t.me/s/AllesAusserMainstream . >1800 cases with an average age of 40 years! The report is in german though… Other Wellness Company with Dr. McCullough contributions at: OnlineHealthNow.com
11/1/2022” Mike Adams interviews Todd Callender with even more extremely important information related to injections, lawsuits, protections: https://www.brighteon.com/c7df9be9-a92d-4dea-896c-5d2bef4a59fe
10/30/2022: New report by Todd Callender and Dr. Lee Vliet at https://www.bitchute.com/video/ptVCPDMSjxoC/ revealed a detection of radioactive Cesium 137 in the covid injection vials. That’s 30.17 years of high energy electron source inside of the human body, if it’s true indeed. Hydrogels are characterized by a temperature dependent swelling essential for their drug release properties. Hydrogels, generally operate at 2.45 GHz frequencies with rapid overheating of the scaffold (“On-Demand Hydrophobic Drug Release Based on Microwave-Responsive Graphene Hydrogel Scaffolds”, Chemistry 2020 Dec 18;26(71):17069-17080.) For some hydrogel types the swelling temperature can be affected by Cs. Since cesium binds preferentially to the opposite elements in the periodic table like chlorine and iodine, its elimination would possibly include those elements. Biochar and charcoal were tested by japanese researchers with good results. Research by russians included structured water properties in radioactivity remedies. The radioactive Cs-137 basics is described on NIST pages:
https://www.nist.gov/pml/ti...
and relates to natural resonance Cs frequency of 9.192 GHz, which is used to define a second in our clocks....Just an association, but maybe the 9.19GHz gets frequency doubled in the presence of graphene and that's what releases the modmRNA around the 18GHz, initiating the complete content release and start of the translation by the ribosomes? Probably the pulse width determines how many of the genes can leave the lipid nanosphere, that's the so controlled release..
The other issue is that our DNA is ALSO emitting COHERENT light in the THz range, once you get harmonics of those, you mix up these natural frequencies necessary for DNA to open/unwind/close etc...
Last thing, it seems to me that 0.001 precision in sec wouldn't be enough resolution for millions of people, but if you take the Cs second, defined in GHz, that would better fit the 'resolution of the SURVEILLANCE detection'. Might be wrong here..
Ever since Celeste Solum pointed to the hydrogels in 2020 already, being applied in covid vaccines, I commented on many web pages about the 2011 synthetic biology book titled “Comprehensive Biomaterials“ by Paul Ducheyne, which described a method to dissolve hydrogels with embedded protein/DNA drugs using simple EDTA in mix with approproate digestive enzyme targeting the biomolecules, the most frequent one, trypsin. Tissue ablation and usage in blood cltohing was equally targeted this way.
10/17/2022: Update about graphene properties producing bioluminescence across the visible spectrum range (middle of the post), explaining observations of covid vials by the RIP Dr. Noack’s and many others. That would also explain the ‘glowing blood vessels’ under UV illumination of the covid injected. Example of Andreas videos were just published at: https://ijvtpr.com/index.php/IJVTPR/article/view/52/96 starting in paragraph 12.NOACK p. 44
10/25/2022: “A new material mimics real blood vessels so well it could drastically change lives“ at: https://interestingengineering.com/science/material-mimics-blood-vessels with the picture of the new material
need to check the ‘ingredients list’ and compare with what the embalmers are collecting…
This is an urgent post, still not finished, but has to go out with what’s in already. Please check for updates, if time allows:) THANK YOU.
The Apr 2022 Stanford publication^1 from Department of Bioengineering at Stanford University AND Chan Zuckerberg Biohub, describes how to engineer SYNTHETIC RNA devices for NATURAL CELL CONTROL. The following picture illustrates the ‘ingredients’:
:
And this one the examples of the devices:
Is that the reason why face-book censored everyone saying bad things about the synthetic mmRNA covid injections?
The most recent publication about covid gene therapy injections, directly related to the synthetic biology, and the correlation between the Sudden deaths ‘syndrome’ following them, is pointing towards few genetic mutations in a human protein (not viral!) named SCN5A^2, which mediates the voltage-dependent sodium ion permeability of excitable membranes. The reports of sudden deaths are growing with every day: https://www.brighteon.com/f3ca1041-3b02-4883-b584-adbd081187e5 and the interpretations from the top scientists do not seem to follow the facts, on the contrary, claims like this one published in Feb 2022 Vaccines (Basel). 2022 Feb; 10(2): 308., quote: ’More than eight billion doses of COVID-19 vaccines have been administered globally so far and 44.29% of people are fully vaccinated’. Further, ‘There have been 55 cases of death after COVID-19 vaccination reported and a causal relationship has been excluded in 17 cases.’ !? Given that I alone know personally 5 cases of deaths AFTER the covid injections (today, 3 days after posting this, one more family member covid injected victim died!!!), that Prof. Burkhard (Germany) is leading studies on 50 deceased bodies AFTER the covid injections (https://www.brighteon.com/3040ff03-1113-46db-b70b-962a55949145), that would make the world count, right there. But then you got the embalmers, who are coming out with massive increase of deaths with never seen before blood changes and foreign structural elements, with an example like this: ‘This Is Genocide’ Says British Funeral Director, College Requires COVID Shots? (Episode 156 with John O’Looney) at https://live.childrenshealthdefense.org/shows/good-morning-chd
, then you got the from ~5% to ~75% increased miscarriages, you got the hundreds of times increased cancer rates, you got the insurance companies having to deal with increased deaths claims, and that all not in 2020, the year of the biggest pandemic in this world, but in the year of 2021/22. the ‘cure’, the begin of the new synthetic modified mRNA transition! So one would need to ask, when will the scientists finally admit the most cruel TRUTH ever, they are participating in? People need to start knocking at their doors, NOW.
That mutated ‘Sudden Death’ protein SCN5A (https://www.uniprot.org/uniprotkb/Q14524/entry) is over 2000 amino acid long membrane protein which works in Ca+2 dependent way. One of its isoforms is expressed only in human atrial and ventricular cardiac muscle. It’s amino acid sequence shows long sections with or negatively charged like (D=aspartic acid,E-glutamic acid) ‘ESDTDDQEEDEENSLGTEEES’ or mainly positively charged: “HERRSKRRKRMS” amino acids (almost like an analog of a battery). The latter reminds me the HIV-TAT protein or the LINE-1 retotransposon, with the former having equally a string of 7 positively charged residues (seldom found in average proteins) which have the lysines (K) and arginines(R) aligned the following way:
471-SHERRSKRR-KRMSSGTEECG-490 ==> HUMAN SCN5A mutated in 'Sudden Death'
57---YGRK-KRRQRRRAH-69 ==> HIV-TAT
379-PLARLIKKK-REKNQI-390 ==>> human LINE-1 retrotransposon
The 2 most frequent mutations in SCN5A in the covid injected victims were Arg1193Gln and Arg1023His which correspond to sections KVWWR*LRK and KVPPTR*KETR with the mutated arginine denoted as R*. Are there homologs of these sections in HIV or maybe even SARS-CoV-2 Spike? Here few fragments aligned by hand:
KVW----WR*LRK mutated first section within SCN5A
HLWRWG-WR*WGTM HIV gp160, precursor
K-WPWYIW--LGFI SARS-CoV-2 Spike
KVPPTR*KETR mutated second section within SCN5A
PNNNTR*KRIRI HIV gp160, precursor
VYAWNR*KRISN SARS-CoV-2 Spike
The SARS-CoV-2 genetic reprogramming was announced by the very first MIT report^3 about integration of SARS-CoV-2 virus into the human DNA via LINE-1 retrotrasposon (https://www.uniprot.org/uniprotkb/O00370/entry). The described integration was based only on testing for the presence of the nucleocapsid protein, which is a highly homologous part of other viruses. MIT team DID NOT check for the integration of Spike, strangely equally ~1200 amino acid long (like the LINE-1 element), genome of which is being injected into BILLIONS of clueless victims.. What if the goal was to ‘fear the virus which can integrate in your genome, making the PCR test for SARSCoV-2 nucleocapsid positive but forget the injected Spike genome’ only in order to ‘safely’ take it as a ‘vaccine’ ?? It is incredible, that it was not revealed, that the infectious section of the HIV-1 gp160 has its homologous section in that LINE-1 retrotrasposon, and in particular that this very same section is equally even better conserved in the SARS-CoV-2 Spike:
Query 924 KQWGKDSLLNKWCWENWLAICRKL 947 Human LINE-1 retrostransposon
++ GK KW W WL L
Sbjct 1201 QELGKYEQYIKWPWYIWLGFIAGL 1224 SARS-CoV-2 Spike
and the same LINE-1 section compared with HIV1 gp160:
24.0 bits(49) 0.064 20/62(32%) 24/62(38%) 30/62(48%)
Query 898 QWNRTEPSEIMPHIYNY--LIF-------DKPEKNKQWGKDSL--LNKWC--WE-----N
+W+R EI NY LI + EKN Q L L+KW W N
Sbjct 630 EWDR----EI----NNYTSLIHSLIEESQNQQEKNEQ----ELLELDKWASLWNWFNITN
Query 940 WL 941 <<< HUMAN LINE-1 retrotransposon
WL <<< IDENTITIES
Sbjct 678 WL 679 <<< HIV1 gp160
Rudolf Jaenisch et al. didn’t mention that there are HUNDREDS of homolog sections of that LINE-1 human retrotransposon conserved in the SARS-CoV-2 Spike, here few examples:
Query 782 KENYKPLLKEIKEDTNKWKNIPCSWVGRIN 811 HUMAN LINE1
K N KP ++I + + + PC+ V N
Sbjct 458 KSNLKPFERDISTEIYQAGSTPCNGVEGFN 487 <=SPIKE ACE2 RBD part
Query 822 IYRFNAIPIKLPMTFFTELEKTTLKFIWNQKR 853 Human LINE-1
I RF I P + + WN+KR
Sbjct 326 IVRFPNITNLCPFGEVFNATRFASVYAWNRKR 357 SARS-CoV2 SPIKE
Query 899 WNRTEPSEIMPHIYNYL 915
WN + YNYL
Sbjct 436 WNSNNLDSKVGGNYNYL 452
Query 1058 KQIYKKKTNNPIK 1070
KQIYK PIK
Sbjct 786 KQIYK---TPPIK 795
Query 815 MAILPKVIYRFNAI 828
MA YRFN I
Sbjct 902 MA------YRFNGI 909
Query 438 LPRLNQ-E-EVESLNRPITG 455
L RL+ E EV+ +R ITG
Sbjct 981 LSRLDKVEAEVQ-IDRLITG 999
Query 704 MIVYLEN-PIVSAQ--NL 718
M V+L P+VS+Q NL
Sbjct 1 MFVFLVLLPLVSSQCVNL 18
And Rudolf is not just anybody, it was him who created the FIRST TRANSGENIC mammal in 1974(!!!) together with Beatrice Mintz while inserting a foreign DNA into a mouse embryos (PNAS 71, no 4 1974. p.1250-54).
There is a bioinformatics tool s.c. ELM server (http://elm.eu.org) which can analyze small human peptides within any protein. The piece from SARS-CoV-2 Spike ‘KWPWYIWLGF’ according to ELM apparently represents ‘MAPK docking motif’. Analysis of LINE-1 results in ‘KIDKWDLIKL’ as ‘MAPK interacting molecules’. While SNC5A has 2 pieces with ‘KWVAYGF’ and ‘YVKWEAG’, none of it appears in ELM output, despite of having listed sequences within identical MAP families DOC_MAPK_gen_1, DOC_MAPK_MEF2A_6. Strange…
So we have Sudden death after Spike injections, related to mutations in SCN5A, both sharing some special features with HIV-1-TAT, HIV-1 gp160, the Spike2020 and now with LINE-1, with reverse transcriptase features, incorporating the SARS-CoV-2 genome into human genome.. Let’s add more confusion.
The recent accumulation of changing of the human blood groups^2, according to this research is related to PIEZO1, pore-forming subunit of a mechanosensitive non-specific cation channel. It is also a membrane protein induced by beta-amyloid and it causes its clearance within a microglia, meaning, if its production is impaired, there won’t be proper amyloid clearance. It plays a key role in blood vessel formation. Among its 2521 residues one can find the unusual triads of Tryptophan sections, like in SCN5A. The same is with the very long segments of positively and negatively charged segments. It appears, that both SCN5A (Sudden Death) and PIEZO-1 (human blood group change) membrane channel proteins share almost 30% sequence identity with just few examples, among countless others:
25.2 bits(52) 0.13 8/15(53%) 10/15(66%) 5/15(33%)
Query 1059 QEEDEENSLGTEEES 1073 SCN5A Sodium channel, Sudden Death
QEE+EE EE+S
Sbjct 749 QEEEEE-----EEDS 758 Piezo1, Blood Group Change
Query 793 LMELG------LSRMSNLSV---LRSFRLL--RVFKL 818
L+EL LSR V LR RLL VFKL
Sbjct 788 LLELAAGFSDVLSR-----VQVFLR--RLLELHVFKL 817
Query 1333 SIMNVLLVCLIFW 1345
S+MN LLV L W
Sbjct 831 SVMNLLLVVL--W 841
Query 915 CLLVF--LLVMVIGNLVVLNLFLALLLSSF 942
CLL F L LV L LFL LLL F
Sbjct 23 CLLRFSGL------SLVYL-LFL-LLLPWF 44
Query 1191 WWRLRKTCYHIVEHSW 1206 <<<SCN5A genetically modified R1193
WWR W
Sbjct 1402 WWR-----------PW 1406 <<<PIEZO1
Query 1187 PG---------------KVWWR 1193 <<SCN5A genetically modified
PG WWR
Sbjct 1383 PGLEPGPDSPGGSSPPRRQWWR 1404 <<<PIEZO1
It clearly looks like these 2 membrane channel proteins are related and the Arg1193 mutation in the ‘Sudden Death’ deceased covid injected victims, is conserved in both. Are the changed blood groups correlated with the Sudden Death effect? One is sure, the genetically programmed Spike production in the human bodies induced by every synthetic mmRNA injection (Pfizer, Mod-E-RNA), clearly must be affecting both proteins, alone due to the steal of identical building blocks. Both proteins SNC5A and PIEZO1, share almost 50% of identities with SARS-CoV-2 Spike, when searching for shorter overlapping fragments. Other issue would be that the impaired PIEZO1 production or its mutation, would result in amyloid formation. The analysis of amino acid content with protparam gives for both proteins rather high aromatic amino acid content, for SCN5A_HUMAN (Q14524) total 10.5% of aromatics:
Phe (F) 124 6.2%
Trp (W) 33 1.6%
Tyr (Y) 54 2.7%
and for the PIEZ1_HUMAN (Q92508) total 10.9% aromatic amino acids:
Phe (F) 127 5.0%
Trp (W) 60 2.4%
Tyr (Y) 88 3.5%
which couples those 2 to the previous post, linking photon absorption with remote genetic control:
The presence of 4 TrpTrp(WW) dipeptides in the PIEZO1 sequence and 5 Trp-rich sections implies a strong UV absorption, the strongest among the SCN5, Spike and LINE-1, but still, never so strong as the one from RNA/DNA, with shifted wavelengths.. Just a quote from the first citation^1:”Genetics research has not only cemented the principles of gene expression control — that RNA molecules transmit genetic information between DNA and protein — but also uncovered the significant role that RNA plays in directly regulating cell behaviour (FIG. 1a).” One of the kind readers (Sally Gould) pointed to this wonderful video summarizing lot of the topics around that theme: https://www.bitchute.com/video/7ISiQ7P8GxAN/
How important the photon propagation inside of the human body actually is??? It appears it is everything in order to feel good, and healthy, we need to sleep without the visible light and create with the light.
The work of Prof. F. A. Popp^7 in the field of Biophotonics indicate that the life of every cell, entire healthy organs is accompanied by low level emission of coherent biophotons with the wavelength in the range of ~350nm. In a cancerous state that intensity increases and it becomes less coherent in the same time. Every single cell division, implying a growth process, requires coordination in space and time, exchange of building blocks, communication beyond that cell, reaching the perimeter of the entire organ, all the way to the entire individual, and beyond. Biophotonics concept of living organisms points to 3 major differences between a healthy and cancerous tissue:
the amount of heat generated in a unit of proliferating healthy tissues increases, whereby in cancerous tissue it is the opposite, the heat decreases
the amount of biophotons in given time interval per unit of proliferating healthy tissue decreases, whereby in cancerous tissue it increases
the coherence of the biophotons in healthy tissue shows an increase per time interval, whereby in cancerus tissue it decreases.
One has to add, that the fact that graphene can affect all 3 processes, implies its possible role in the very same cancerous disaster as any other non-biological or synthetic biological material out there. If anyone followed the Pfizer whistleblower who was showing the bluish fluorescing injection vials, here would be one of the explanations: graphene is capable of photoluminescence, in the entire visible spectrum (https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.105.127404) . By changing the percentage of graphene amount in specific metallic solutions the colors can be changed across the entire rainbow ( https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9000643/ )!!! The emitted radiation is partly coherent with the excitation light!! That’s like overwriting your entire HUMAN bioluminescence from inside of your body! Imagine the weather geoengineers are spraying us with this! We ALL need HELP, NOW. The just published article was posted by Dr. Ana at:
The opto- to magneto- or opposite signalling pathway within biological matter was studied on migratory birds. It resulted in finding a protein called cryptochrome CRY4. Humans do not have CRY4, instead CRY1 and 2, which share ~50% identity with the birds cryptochrome and play a role in human cardican system, all essential for the s.c. geotaxis. 2021 paper^8 about CRY4 states, quote:”Site-specific mutations of ErCRY4 reveal the roles of four successive flavin-tryptophan radical pairs in generating magnetic field effects and in stabilizing potential signalling states in a way that could enable sensing and signalling functions to be independently optimized in night-migratory birds.”
That’s incredible, TRYPTOPHAN photons absorbing/emitting amino acid, now is generating magnetic fields, normally mainly connected with iron containing macromolecules, like ferritin, for example, or take our blood due to hemoglobin with 4x Fe+2→Fe3+. So we got this photonics crossing with magnetism, alone due to the features of the simple amino acid tryptophan, and then they are all so well conserved in HIV-1 TAT, HIV gp160, SARS-CoV-2 Spike, SCN5A, PIEZO1, and maybe many more. With all this, why the mandates for the universal gene manipulation in every human on the entire planet?
Among countless patents related to HIV drugs (Fauci will retire so leaving him out for now), therapeutics, one stands out, with priority date of 2008, by Loren D. Walensky (CDC director’s husband) and Gregory H. Bird : https://patents.google.com/patent/WO2009108261A2/en . It’s benign title: “Compositions and methods for the treatment of viral infections” indicates actually ‘treatment’ methods for paramyxovirus, orthomyxovirus coronavirus, influenza and a filovirus, thus for example HIV, ebola, influenza, SARS, HRSV.
Its abstract states, quote:”The present invention is directed to compositions, kits and methods utilizing polypeptides with stabilized α-helical structures (herein also referred to as SAH). The compositions are useful for treating and/or preventing viral infections. The invention is based, at least in part, on the result provided herein demonstrating that viral hydrocarbon stapled alpha helical peptides display excellent proteolytic, acid, and thermal stability, restore the native alpha-helical structure of the peptide, are highly effective in interfering with the viral fusogenic process, and possess superior pharmacokinetic properties compared to the corresponding unmodified peptides.” Anything biologically modified is always OR ‘gain’ OR ‘loss’ of function, according to synthetic biology ‘recipes’. Walensky & Co, in 2008 listed 14 peptides, two of which SEQ ID 7 and SEQ ID 8 are ~90-100% IDENTICAL with the 2020 SARS-CoV-2 Spike. All the other, are equally partly to be found within the Spike sequence, given that even the 30% IDENTITY would be enough to have similar physiological consequences claimed in the patent. One example, the SEQ ID 13: “MTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLE” when given into BLAST and searched for identities between Spike 2020 (YP_009724390.1), will only give shorter segments, for example:
Query 27 QQEKNEQELL 36 2008 WALENSKY's SEQ ID 13
+Q+KN QE+
Sbjct 773 EQDKNTQEVF 782 Spike 2020 (in human bodies)
Query 21 IEESQNQQE 29
+E+ +N QE
Sbjct 772 VEQDKNTQE 780
Query 3 WME 5
WME
Sbjct 152 WME 154
Query 19 SLIEESQNQQE--KNEQ 33
SLI+ QE K EQ
Sbjct 1196 SLID----LQELGKYEQ 1208
but the entire piece seems to fit, only BY HAND:
MTWMEWD-REI----NNYTSLIHSL--IEESQ-NQ-QEKN--EQEL---LE 2008 SEQ ID13
+WME + R + NN T S + + + Q + KN E + ++
KSWMESEFR-VYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREF-VFKNID Spike 2020
the last by hand made alignment implies that >50% identical amino acids of that section can be used with all other pieces to CROSS-LINK with other of the PATENTED helices. It is ALL BASED upon the well known feature of HIV-gp41 protein, the one connected to gp120, ‘reducted’ to be connected with Spike. The patent lists additional modified polypeptides, among others, quote:
‘The modified polypeptide of claim 25, wherein said chimera has the amino acid sequence of or right behind it with ‘substitutions’
WQEWEQKITALLEQAQIQQEKNEYELQKLDKWASLWEWF’
YTSXIHSXIEESQNQQXKNEXELLELDXWASXWNWF
in which X is any amino acid and B is Methionine or norleucine. BLAST won’t align it, but here by hand, just the last section of it:
Query KNEXELLELDXWASXW-NW--F Walensky's 2008 patent
K EQ + KW PW W F
Sbjct KYEQYI----KW--PWYIWLGF SARS-CoV-2 Spike2020
That’s again and again, the HIV homologs, topics so dear to Fauci’s heart, the great collaborator with Walensky’s family. Does one need to wonder why all this ends up with posts like the one from Steve:
If all the heptad helices are so powerful in crosslinking themselves via certain modified amino acids, or attached chemical groups, like sugars(?), doesn’t is sound like a never ending possibility to build artificial protein networks, which look like CLOTS and fill out the bodies of the clueless VICTIMS by the tiny covid injection with never dying modmRNA
??? Just a speculation.. But this one is less, and that’s the CDC/Walensky strategy, which goes this way, on the 12th of Sep 2022:
https://www.bloomberg.com/news/articles/2022-10-12/pfizer-moderna-omicron-boosters-get-fda-nod-for-kids-5-and-up
FDA Authorizes Covid Omicron Boosters for Kids 5 and Up
that’s Mrs. Walensky, and the next day, 10/13/2022:
https://www.genomeweb.com/cancer/st-jude-broad-institute-dana-farber-partner-advance-pediatric-cancer-research
St. Jude, Broad Institute, Dana-Farber Partner to Advance Pediatric Cancer Research
That’s Mr. Walensky.. Overall it gets even better, new announcement on the 18th of Oct 2022: https://interestingengineering.com/health/biontech-cancer-vaccines-by-2030
or few days before that, Moderna Inc. has teamed up with Merck, to develop a personalized vaccine against skin cancer (https://interestingengineering.com/health/moderna-merck-personalized-skin-cancer-vaccine).
Didn’t we just read that the biophotonics, among others is based on the strongest signals from for example tryptophans, and is related to cancers?? How interesting, one family member deals with controlled demolition dictated by CDC, the other with its repair, way in advance of the demolition… In case of the companies producing covid gene modifying injections, the phase III world-wide trial gave them great opportunity to gather the data about these cancers, which they now are working on to ‘fix’, apparently… When do people realize that most evil pharma drug cartels tactics on humanity on still OUR PLANET??? When you read this article by MIT Technology Review titled “Technology that lets us “speak” to our dead relatives has arrived. Are we ready?“ at: https://www.technologyreview.com/2022/10/18/1061320/digital-clones-of-dead-people/
you have to finally start putting the dots together, that we are treated with the tip of infinite arrogance NOT AS HUMANS, but some kind of animal, on the way to a new digital transition!
The goal in todays’ world, is having more of like this fellow, not in science though, but with impressive outcome: https://forbiddenknowledgetv.net/thierry-baudet-vs-the-marxist-dutch-parliament/
That would leave lot of space for new people eager to find out the truth and stand for HUMANITY, hopefully.
When people are going finally to start understanding their true purpose on this planet, expressed in a clear way like by this lady: https://uncutnews.ch/die-rede-von-meloni-zeigt-warum-der-mainstream-durchdreht/
Dr. Suharid Bhakdi cries out to all scientists who went not only along with WHO/FDA/CDC/NIH et al. re-definitions, but in particular forgot the basics, so he REMINDS all scientists about this fact at: https://uncutnews.ch/prof-bhakdi-es-steht-etwas-bevor-was-die-menschheit-gefaehrden-wird/
It is about ANTIBODIES: plasma B cells or effector B cells are producing anti-bodies only in blood. How comes that a virus which never sees the blood, suddenly shall see the anti-body floating freely only in blood, it gets even better, how that virus always on mucus membranes first, GETS even NEUTRALIZED BY THE ANTI-BODY floating in the blood? Anti-bodies are the supposed end goal of every vaccine, including the covid19 genetically modifying injection materials! Apparently every single person has different antibody to one and the same virus. So how do the FEW antibody tests actually work on billions of people each with different anti-body to one and the same virus? This is REALLY CONFUSING, to say the least. And then you got the variants. Please leave some comments with hints.
The mentioned ELM bioinformatics data base called: “The Eukaryotic Linear Motif resource for Functional Sites in Proteins”
at http://elm.eu.org/ detects eukaryotic linear motifs (ELMs) within any protein. When submitting the SAR-CoV-2 spike sequence one receives a huge list of known HUMAN motifs with extremely important functions within the SARS-CoV-2 Spike.
The by Dr. Walensky patented 2 sequences SEQ7 and SEQ8, have all their ELM motifs identical with the Spike, just less of them due to their much shorter sequence (~70 aa’s vrs 1273aa’s in SPike). Just do not forget, Spike is non-human, synthetic, BUT covers so many of the human proteins!
The TIP of the already patented future, completely new biology within s.c. Biomanufactured Products, including US HUMANS, is being helped with by nobody less than the Harvard Prof. George Church:
In 2019 he gave an official apology for:
https://www.statnews.com/2019/08/05/citing-nerd-tunnel-vision-biologist-george-church-apologizes-for-contacts-with-jeffrey-epstein/
and in 2011 co-founded the ‘Warp Drive Bio’, quote:”Co-founded by Harvard Medical School professor of genetics and genomics expert George Church, Ph.D., Warp Drive Bio was launched by Sanofi and Third Rock Ventures back in 2012 with $125 million and a mission to “build an innovative genomics search engine to reveal nature's drugs.” The list of Dr. Church involvements has no end:
https://www.quora.com/What-is-a-list-of-all-the-companies-that-George-Church-serves-on-the-advisory-board-of
and his 2 newest patents (from https://patents.justia.com/inventor/george-church) sound very ‘promising’:
Publication number: 20220282263
Abstract: Provided herein are methods of generating engineered organisms with targeted genome designs, such as recoding designs, and targeted functional properties. Also provided are methods of generating biomanufacturing engineered organisms and uses thereof for production of biomanufactured products.
Filed: May 14, 2020 Publication date: September 8, 2022
Inventors: Ryan Gallagher, Alexis Rovner, George Church, Jeffrey Way, Pamela Silver
and the
Publication number: 20220228104
Abstract: Provided herein are engineered organism containing a transgene in which expression of the transgene in an open environment is prevented or reduced, for example, by recoding designs. Also provided are methods of producing such engineered organism and use of such engineered organisms as therapeutics or for producing food, food supplement, and animal feed products.
Filed: May 14, 2020 Publication date: July 21, 2022
Inventors: Ryan Gallagher, Alexis Rovner, George Church, Jeffrey Way, Pamela Silver.
When you look at VAERS reports of injuries and deaths after all covid19 injections, it seems like these patents are just in time for the ‘saving’ of humanity, quote from the Justia website: “Biologics, according to the present invention include, but are not limited to, allergenic extracts, blood components, gene therapy products, human tissue or cellular products used in transplantation, vaccines, antibodies, cytokines, growth factors, enzymes, thrombolytics, and immunomodulators, among others. A biologic polypeptide of the present invention may be utilized to treat conditions or diseases in many therapeutic areas such as, but not limited to, blood, cardiovascular, CNS, dermatology, endocrinology, genetic, genitourinary, gastrointestinal, musculoskeletal, oncology, and immunology, respiratory, sensory and anti-infectives.“
Dr. G.Church was a sitting member of one of the covid19 commissions. With his incredible work at Blavatnik Institute at MIT (installed by Sir Leonard Valentinovich Blavatnik, a russian philanthropist of Ukrainian Jewish origin), and the spectacular statement in 2017 National Geographic, one would need to ask, if Dr. Charles Lieber collaborated with China which lead to false IRS filings and a jail, why is Dr. Church still running around free? Seems like re-writing all the nature is not a felony, but taxes are..??? That not to say, what Dr. Lieber was doing was ‘for the good of humanity: https://expose-news.com/2022/11/14/flashback-charles-liebers-liquid-computing/
The most recent summary by Amazing Polly related to Dr. Church’s achievements is presented here:
https://forbiddenknowledgetv.net/crispr-the-great-reset-for-human-genes-eugenics/
Literature.
Peter B. Dykstra et al. “Engineering synthetic RNA devices for cell control.”Nat Rev Genet. 2022 Apr; 23(4): 215–228. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9554294/
Chupong Ittiwut et al. “Genetic basis of sudden death after COVID-19 vaccination in Thailand.” Heart Rhythm 2022 Aug 5; S1547-5271 (22) 02266-4. https://pubmed.ncbi.nlm.nih.gov/35934244/
Liguo Zhang et al. “SARS-CoV-2 RNA reverse-transcribed and integrated into the human genome.”
Vanja Karamatic Crew et al. “Missense mutations in PIEZO1, encoding the Piezo1 mechanosensor protein, define the Er red blood cell antigens” Blood 2022 Sep 19;blood.2022016504.
Seyed ehsan Hosseininejad et al. “Reprogrammable Graphene-based Metasurface Mirror with Adaptive Focal Point for THz Imaging“ Scientific Reports volume 9, Article number: 2868 (2019)
“Scientists discover they can pull water molecules apart using graphene electrodes“ https://phys.org/news/2022-10-scientists-molecules-graphene-electrodes.html
Fritz A. Popp “Biophotons - New Horizons in the Medicine”
Jingjing Xu et al. “Magnetic sensitivity of cryptochrome 4 from a migratory songbird“ Nature. 2021 Jun;594(7864):535-540. https://pubmed.ncbi.nlm.nih.gov/34163056/
I get so lost reading this hard scientific work. Can this be broken down into easier to understand language for the average reader? It’s so over my head but it looks like we need to know/ understand. Thx❤️ To all who are working so hard to get the data and the Truth out to the ppl
So, so brilliant!
But so hard for a stupid person like me.
Just wow! Tryptophan and iron! Tryptophan, in the manner of iron, in its ascendancy, now has a role in crossing photonics with magnetism. Fascinating.
All I could think of is how glyphosate has an effect on the shikimate pathway, which ultimately impedes the production of tryptophan. Thoughts on this, please?
And should people be supplementing with tryptophan? Would supplementation with tryptophan enrich the conserved tryptophan in all of the enumerated proteins?
And if you can further elaborate on the relationship between photons and magnetic fields, it would be ever so helpful. Many of us blithely employ photobiomodulation and frequency devices.
Sorry for all of the questions. In abject appreciation, I offer my huge thanks for all of your kind efforts.