Catecholamines, 5G and the deaths after the covid19 genetic modification injections, falsely called 'vaccines'.
Please scroll behind the divider line for the above article. First just some recent news:
11/4/2022: A good source of EMF mitigation tools, detectors, meters, shielding at:
10/11/2022: https://forbiddenknowledgetv.net/self-inflicted-castration-of-our-national-defense-heartfelt-whistleblower-testimony-lt-col-dr-long/
9/1/2022: Alex Berenson from ‘Unreported Truths‘ pointed to this japanese study:
https://onlinelibrary.wiley.com/doi/epdf/10.1002/cia2.12278
which begs the question: Pfizer (possibly Mod-E-RNA too), will your modified mRNA ever DIE in the human bodies??? Thanks Alex and ALL THE JAPANESE researchers, who seem to be the only one who have the guts to speak out the truth!
7/25/2022: important hint for a preparation of a new, old style crime, in a MIT Report at : https://www.technologyreview.com/2022/07/23/1056399/monkeypox-california-wastewater/
MIT’s 23rd of July article:”Monkeypox is in Bay Area wastewater”, the same day WHO announces ‘Mon-key-pox outbreak‘..
7/27/2022: why covid injections are NOT ‘vaccines’ in swiss news at https://uncutnews.ch/2-videos-die-mrna-des-impfstoffs-verandert-das-genom-und-das-immunsystem/
8/3/2022": Genetic modifications of humanity via the synthetic covid mRNA injection materials, are going to have enormous consequences, all in preparation RIGH NOW! Here todays email news from genomeweb.com, invitation to:
“Early Bird Rate: Hear from International Newborn Sequencing Experts in Boston”
“Learn how DNA sequencing is being implemented globally as a diagnostic and screening strategy for newborn children at the inaugural International Conference on Newborn Sequencing, to be held October 5-6, 2022, at the Museum of Science in Boston.”
8/28/2022: 1000 studies presenting covid gene therapy injections injuries: https://community.covidvaccineinjuries.com/compilation-peer-reviewed-medical-papers-of-covid-vaccine-injuries/
The 5 months old post:
was a short introduction into the details of synthetic Spike production, which now is happening on a world wide scale, in bodies of all the injected with SARS-CoV-2 synthetic modified mRNA of the SPike, reprogramming the human bodies for the production of the synthetics, which literally means, we are dealing with genetically modified victims. That post brought into attention the importance of an aromatic amino acid tyrosine, a neurotransmitter precursor, which influences catecholamine production and transmission^1. In the meantime more autopsies of the deceased after the illegal (without human consent to gene therapies) procedures were done (in particular the case of the 2 young boys^2) with the result, quote: “The microscopic examination revealed features resembling a catecholamine-induced injury, not typical myocarditis pathology.“ and further “injury.. most closely resembling a catecholamine-mediated stress (toxic) cardiomyopathy.“ Wiki at https://en.wikipedia.org/wiki/Catecholamine describes what catecholamines are, aromatic small molecules, all derived from tyrosine and their pathway involves :
the very same VMAT-2 gene (GOD-gene) product which I also mentioned in the letter to FDA, while summarizing the tiny portion of bioinformatics on the SARS-CoV-2 Spike protein:
Dopamin is the first molecule released by the human brain in the moment of the so called ‘love at first sight’^3. Deletion of the VMAT-2 gene (the transporter for the neurotransmitters, i.e. catecholamines) is lethal^4, reduction of the VMAT-2 protein production clearly will cause neurological issues^5^6. Reserpine, an irreversible and non-specific VMAT1/2 inhibitor depletes dopamine in biological tissue and causes parkinsonism in rats^7. One can only imagine, that any modulation of the VMAT-2 gene expression, which depends on the availability of all its building blocks, and anything like GENETIC REPROGRAMMING of every cell (Pfizer and Mod-E-RNA shots) to steal in orchestrated fashion lot of it for the non-human Spike production after covid gene therapy injections, will be detrimental. VMAT-2 in an ATP-dependent manner pumps the cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles (uniprot entry), thus taking Prof. F.A. Popp’s words literally, VMAT-2 participates in the ‘initiation of love’, in the material world we know.
The C-terminal portion of human VMAT-2 protein compared with a snake VMAT-2 (https://www.uniprot.org/uniprotkb/Q05940/entry), with its commercial antibody and the Spike2020 from all the universal covid injection materials, is the following:
C-SYPIGEDEESESD ==>sequence of the commercial VMAT-2 antibody
14.6 bits(26) 24 Compositional matrix adjust. 8/17(47%) 12/17(70%) 1/17(5%)
just one example out of quite few:
Query 358 WLCALLGMI-IVGVSIL 373 >>HUMAN VMAT-2
WL + G+I IV V+I+ >> IDENTITIES
Sbjct 1217 WLGFIAGLIAIVMVTIM 1233 >> Spike 2020
and since NIH bioinformatics software packet BLAST will never align C-terminal portion, here it is done by hand, including the same homolog from snake species in the last line:
MAILMDHNCPIKTKMYTQNNIQSYPI-GEDEESESD >>>>>HUMAN Vmat-2
M+ C +K + + ++++SE
MT--SCCSC-LK-GCCSCGS-CCK---FDEDDSEPVLKGVK >>>SPiKE 2020
M+ C K + S ++ D++DSE
MAILMDHNCHFKTKMYTQNSIQSHQLGGDDEDSESD >>>>>>>>SNaKE Vmat-2
CSYPIG-EDEESESD>COMMERCIAL VMAT-2ANTIBODY
As one can see, the homology of the SPiKE2020 protein to the SNaKE version of VMAT-2 is somewhat nearer. A presence of FIVE negatively charged amino acids is definitely not random, in my opinion, in particular if it could potentially mimick the anti-body, after proteolytic digestion of the Spike, to limit the production of this protein in the human body. The mentioned stateofnation extensive article with the title:”Vmat2, FunVax Vaccine and Adrenochrome – a tentative investigation” brings the adrenochrome into the picture of this ‘broken heart’ story^8, which I will leave out here for now.
What is worth repeating once again, is that all the catecholinergic aromatic neurotransmitters are sensitive to light, absorb it and emit, like tyrosine, which brings up the connection to the so called optogenetics^9. The by the elites anticipated brain manipulation is for the one purpose, I do believe, after all, we all should own nothing, be nothing and be happy, which does not mean to be human, but some kind of programmable computer interface, without love in heart, in the first place. One of the commenters below, pointed out this documentary, connecting the dots for everyone in the documentary titled “GLOBALIST POPULATION CONTROL Rothschild Rockerfeller Club of Rome“:
https://www.bitchute.com/video/PmoHsJzWORPF/
Experiments on rats showed how to optogenetically stimulate neurons and effect the breathing patterns while causing cardiorespiratory activation^10. The neuronal modulation of catecholamines^11 can definitely contribute to yet another report^12, whereby the very recent report of 3 dead doctors from Trillium Health Partners (Mississauga Hospital), points in my opinion, to the new 5G technologies, which affect the very same catecholamines, involved in the cause of these cases^13. Here a paste of the 3 tables from that publication no 13, one with the characterization of the participants of the study and the results in each of the groups:
TABLE 1. General Characteristics of Volunteers
Characteristics Control (n ¼68) Group I (n ¼40) Group II (n ¼58)
Exposure details
Radar exposure Nil X band, 8–12 GHz Ku band, 12.5–18 GHz
Years of service, range (in years) 12.2 6.3, 1–28 8.3 5.3, 1–26 11.5 4.1, 1–23
Mean age (in years) 31.9 6.0 27.9 5.2 31.4 4.0
Age range (in years) 21–48 20–45 20–43
Years of education
Matriculation (10) 58 (85.3) 34 (85) 31(53.5)
Higher secondary (12) 3 (4.4) 0 (0.0) 10 (17.2)
Graduation or above (15) 7 (10.3) 6 (15) 16 (27.6)
Personal habits
Tobacco (cigarettes) 20 (29.4) 14 (35) 15 (25.9)
Alcohol 25 (36.8) 17 (42.5) 37 (63.8)
Tobacco (smokeless) 14 (20.6) 12 (30) 13 (22.4)
Plus or minus values are mean SD or n (%) unless otherwise specified.
TABLE 2. Catecholamine Concentration in Defense Personnel Exposed to Electromagnetic Field From Radar and Control
Group
Catecholamine Control Exposure Group I Exposure Group II
Adrenaline 100 13.08%, n ¼53 128.42 15.67%, n ¼39 55.08 9.16%, n ¼44*
Nor-adrenaline 100 18.96%, n ¼43 100.22 15.19%, n ¼32 114.58 12.03%, n ¼52
Dopamine 100 15.04%, n ¼46 138.07 19.15%, n ¼27 70.81 13.87%, n ¼42
Values are mean SEM, expressed in percentage, P <0.05.*Repre
TABLE 3. Catecholamine Concentration in Defense Personnel With Regard to Years of Service (YOS) Category
Service category Control Exposure Group I Exposure Group II
Up to 9 years service
Adrenaline 100 21.4%, n ¼20—108.98 13.07%,n ¼27—60.45 15.12%, n ¼19
Nor-adrenaline 100 23.23%, n ¼17—99.92 17.8%, n¼23—127.44 18.84%, n ¼23
Dopamine 100 27.71%, n ¼15—121.11 23.58%,n¼15—48.95 15.80%,n ¼16
10 years service
Adrenaline 100 16.72%, n ¼33 162.22 42.08%, n ¼12 49.91 10.97%, n ¼25
Nor-adrenaline 100 28.2%, n ¼26 92.91 28.08%, n ¼9 103 15.12%, n ¼29
Dopamine 100 18.02%, n ¼31 153.64 31.36%, n ¼12 85.07 20.48%, n ¼26
Values are mean SEM, expressed in percentage, P <0.05
The above numbers speak for themselves, plus don’t you do tests when you know that something is wrong? ‘Even’ the currently widely used 2.45GHz wi-fi radiation is known to affect rabbits’ hearts ^14, just in this one more example.
Bioinitiative reports at https://bioinitiative.org/table-of-contents/
summarize lot of the past work which was done in the at that time available wi-fi frequencies. With todays’ resources and limitless allowances for scientists to perform genocide on completely unknown scale (FCC allowance for this top researcher to beam 1050GHz on humanity in the Buffalo area…):
From NANO-MATERIALS to MACRO-SYSTEMS [NANO-NETWORKING in TERAHERTZ & Beyond] (Dr. Josep M. Jornet)
https://www.bitchute.com/video/FJtsdQ073zg8/
will leave those, who know what this means, extremely concerned, if not paralyzed.
There is very general mechanism which can explain the interaction of water absorbing all the GHz frequency ranges, in particular around 60GHz by the oxygen:
https://www.phys.hawaii.edu/~anita/new/papers/militaryHandbook/rf_absor.pdf
both in the proteins and genetic material like DNA/RNA. This mechanism involves 3 effects, one s.c. water hydration shell around proteins/RNA/DNA and interactions with it, second, participation of single water molecules in essential enzymatic reactions, third, presence of water wires inside of proteins, in particular all Toll-like receptors, tightly regulating immune responses, or s.c. LRR (leucine rich repeat) proteins. Water wires’ function is still being discovered:
https://nationalmaglab.org/news-events/news/water-wires
with the most recent paper on effecting K+ flow through the cell membranes and its effects on timescale can be found at: https://www.pnas.org/doi/10.1073/pnas.2001083117
its title:”Functional stability of water wire–carbonyl interactions in an ion channel”
All the Ca+2, Na+, K+, Cl-, and so many other ions flowing inside our bodies are charged and will undergo basic interactions with external EMF fields, something what basic electrodynamics teaches us. Prof. F.A. Popp goes one step further, while investigating physiological phenomena in human bodies, he is using quantum physics to describe it, and couples everything to light, single coherent photons coordinating the infinite amounts of reactions running our bodies every time interval of our lives. The amount and ‘quality’ of those photons is connected to our well-being.
Overwriting those specific light packets with certain frequencies is the no 1 goal of our enemy, who hates HUMANS, and thus LIGHT. One way to do that, is to of course inject billions of people with ‘just the right ingredients’, disclosed recently (Aug 2022) and posted by and incredible group of specialists, available at:
https://s3.documentcloud.org/documents/22140176/report-from-working-group-of-vaccine-analysis-in-germany.pdf
The heaviest ingredient in the HUMAN genetic material is phosphorus(15), an element in the same group no 15 of the periodic table(PT) as nitrogen(7), arsenic(33), antimony(51), bismuth(83) and the last one, the heaviest synthetic one with the name MOSCOVIUM (115). The german researchers are finding antimony (Sb symbol with 51 electrons in total) in Mod-E-RNA covid injections, which is highly toxic. The common number of electrons in the outer shell in every group of PT for its all members makes their somewhat related physical and chemical properties. That is what is beghind the basis of geoengineering sprayings with barium and strontium, elements from group no 2, sharing similar properties as the most important biological minerals calcium and magnesium:
The covid injections are targeting the very same genetic material our bodies are consisting of, alone by regulating and affecting the expression of the pool of the NATIVE mRNAs, with much shorter life span than the synthetic material. that’s why the REPROGRAMMING, named very clearly by the genetic injections manufacturers. The complete change of the synthetic mRNA ‘ingredients’ list, is obviously ending up with different spectroscopical features, and thus light properties. Please, stay tuned, the research never ends:) And in the meantime, AVOID ANY pharma injections like the real pest.
Urgent update. Ever since March, when I started to write about the catecholamines other substack writer ‘moderndisconent’, started also to write about catecholamines, a topic which that person seems to expand in totally different direction as I do. When you search on duckduck go for key words ‘substack catecholamines’ ONLY that persons substack shows up. Just wonder WHY???
Literature:
‘The Dipeptides Ile-Tyr and Ser-Tyr Exert Distinct Effects on Catecholamine Metabolism in the Mouse Brainstem’ Kazuki Moriyasu et al. Int.J.Peptides 2016, article No. 6020786.
‘Autopsy Histopathologic Cardiac Findings in Two Adolescents Following the Second COVID-19 Vaccine Dose’. James R. Gil et al. Arch Pathol Lab Med. 2022 Feb 14. https://pubmed.ncbi.nlm.nih.gov/35157759/
“Biophotonen - Neue Horizonte in the Medizin” Fritz-Albert Popp.
lot of referernces at https://stateofthenation.co/?p=13552
“Genetic deletion of vesicular monoamine transporter-2 (VMAT2) reduces dopamine transporter activity in mesencephalic neurons in primary culture“ Hideko Yamamoto et al., Neurochem Int. 2007 Jul-Sep;51(2-4):237-44.
https://pubmed.ncbi.nlm.nih.gov/17664021/
“Knockout of the Vesicular Monoamine Transporter 2 Gene Results in Neonatal Death and Supersensitivity to Cocaine and Amphetamine“Yan-MinWang et al. Neuron, Volume 19, Issue 6, December 1997, Pages 1285-1296 https://www.sciencedirect.com/science/article/pii/S0896627300804195
“The vesicular monoamine transporter 2: an underexplored pharmacological target” Alison I. Bernstein et al. Neurochem Int. 2014 Jul; 73: 89–97. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5028832/
“Adrenochrome and related oxidative metabolites of catecholamines: effects on dopamine neurons and receptor binding profiles“ John L Krstenansky et al, Schizophr Res. 2011 Dec;133(1-3):264-5. https://pubmed.ncbi.nlm.nih.gov/21906912/
“Development of the Wireless Instantaneous Neurotransmitter Concentration System for intraoperative neurochemical monitoring using fast-scan cyclic voltammetry”. Jonathan M Bledsoe et al. J Neurosurg. 2009 Oct;111(4):712-23. https://pubmed.ncbi.nlm.nih.gov/19425890/
“Breathing responses produced by optogenetic stimulation of adrenergic C1 neurons are dependent on the connection with preBötzinger complex in rats“Milene R Malheiros-Lima et al. Pflugers Arch. 2018 Nov;470(11):1659-1672.
“Role of catecholamines in the genesis of arrhythmias”. B D Bhagat et al. Adv Myocardiol. 1980;2:117-32.
“Vaccine-Induced Myocarditis in Two Intern Doctors in the Same Night Shift“ Mustafa Emin Canakci et al. July 2022, Case Report in Prehospital and Disaster Medicine.
“Occupational EMFExposure From Radar at X and Ku Frequency Band and
Plasma Catecholamine Levels“ Sarika Singhand Neeru Kapoor, Bioelectromagnetics 36:444^450 (2015).“Effects of acute exposure to WIFI signals (2.45 GHz) on heart variability and blood pressure in Albinos rabbit“ Linda Saili et al., Env. Toxicology and Pharmacology 40(2015), 600-605.
probably why they insist on the military injections... they don’t want anyone second guessing their orders due to the intrusion of feelings of humanity.
MejBCart, thanks again for answering my first 7 questions at https://ilki.substack.com/p/vax-questions-for-experts/comments
I had an 8th question. Would you like to answer it? Here it is.
8. I recently published IS MICROBIOLOGY SOUND? at https://ilki.substack.com/p/is-microbiology-real?utm_source=substack&utm_campaign=post_embed&utm_medium=web and I quoted Dr. Harold Hillman's paper in which he discussed problems with Subcellular Fractionation and ELectron Microscopy which he claimed produce artifacts in chemical reactions and in cells that aren't real, but which nonetheless microbiologists assume are real. I also included this statement and quote which supports Hillman's warnings: This MIT news article at https://news.mit.edu/2009/electron-microscope says as follows. "(B)iologists have been unable to unleash the high power of electron microscopes on living specimens, because of the destructive power of the electrons. The radiation dose received by a specimen during electron microscope imaging is comparable to the irradiation from a 10-megaton hydrogen bomb exploded about 30 meters away. When exposed to such energetic electron beams, biological specimens experience rapid breakdown, modification of chemical bonds, or other structural damages."
_So my question is, do you experts have reason to think that mainstream microbiology is sound or unsound and, if so, what are your main reasons, stated briefly?
_PS, in the post at mejbcart.substack.com/p/catecholamines-5g-and-the-deaths , is it saying that the mRNA in the vaxes cause cells to waste amino acids to form spike proteins and thus starve organs, such as the brain, of these vital amino acids? Why isn't the body's immune system able to sequester the vax mRNA to keep it from robbing the cells?