The main post is behind the divider bar, first some updates:
2/4/2024 : If there is any connection between DiseaseX and any old vaccine or not even talking about genetic modifications, by this MD who finally admits some of the truth:
https://forbiddenknowledgetv.net/dr-dan-neides-gives-tearful-apology-for-pushing-vaccines/
1/30/2024: the ‘symptoms’ of a targeted person: https://www.brighteon.com/8d023fa5-ff19-452b-b740-cff118da3681
1/21/2024: What does the ‘modern medicine’ has in bag for us humans? At the very end.
1/19/2024: Update on live Ebola ‘vaccines’ applied in Denver (CO), in the middle of the post.
1/17/2024: Updates with Davos ‘24 videos at the end of this post.
We do not know, unless every single one of US says NO, to any/every-thing connected with the next ‘p(l)andemic’, be it X or Y or Z. Unfortunately too many have listened to the authorities and followed their contradictory instructions in the first covid19-I trial, whether by putting that suffocating mask on or worse, allowing to be injected with genetically modifying biological weapons agents.
Can now a single letter be the cause of the next fear pandemic?
First, X is everywhere, as the 24th letter in the alphabet, anything UNKNOWN gets the label x, but then, we also got the films, just recently from Mr. Len Blavatnik’s A24 group:
and another one coming up in 2024, with 3xX:
yes, the same old Len Blavatnik^1 who sold his stake in Russian aluminum producer United Co. Rusal International PJSC, the world's second largest aluminium (Al) company by primary production output (as of 2016). It was the largest until overtaken by China Hongqiao Group in 2015 (wiki source, sorry). Where does all this aluminum go? Just wonder, how much of it is being used in geoengineering efforts, with X’s invasion on our skies, almost every day, for decades:
And surely the HAARP facility connected with the above, is like a degenerated X-mushroom collection in a futuristic forest on many acres of a cold/hot (depending on emission energy) Alaska land:
and this looks like a tiny miniature of the above, on every cell of the human bodies, a self polymerizing laminin, giving you the smooth texture of YOUR HUMAN BODY, including the BRAIN^10 (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10358660/)
Going back, how much of the overall Al production is in vaccines or in the new genetically modifying mod mRNA concoctions, in daily products, all ending up in many brains of Alzheimer patients? Sorry for this sidetrack, the amount of X-events just strangely accumulates, and hopefully it does not come out of the light cone linking past, presence and future:
First we got SpaceX (why not Space A, or I, no, it had to be X), thousands of them, spinning like Locusta migratoria giving the ‘vital connections’ to so many:
then it got even worse, Twitter turned into X too:
We already got the X chromosome, one of the two (female and male) sex chromosomes:
not only linked to autoimmune diseases (https://www.nature.com/articles/d41586-024-00267-6), but equally with that so attacked ACE2, positioned exactly on that X-chromosome at location, Xp22.2…^6 , and so heavily involved in covid19^9. And now, on top of it we got the Disease-X everywhere in news, including the latest discussion with the worlds health minister and impossible burger addict Mr. Gates, who explains the details at https://forbiddenknowledgetv.net/disease-x-is-scheduled-for-discussion-on-january-17-at-davos/ .
The mysterious Disease X can’t be the impossible chromosomal transformation X→Y, and Y→X since ~half of the members of WHO’s Transgender-Health-Committee are not MD’s but rather political LBGT activists^2, all knowing, that once you annihilate your ORIGINAL reproductive organs, the new ‘replacement’ not only does not work, but ignites a plethora of psychological issues, including suicides. A German Prof. Ulrich Kutschera dissects this topic^3 while mentioning the name of Prof. John William Money from John Hopkins University’s (the same JHU with its ‘Event 201’ in covid19-I plan) and implying a JHU’s role in ‘scientific justification’ of pedophilia^4….
Some of the participants of the lastest JHU Oct 2022 prediction for the ‘Catastrophic Contagion’ https://centerforhealthsecurity.org/our-work/tabletop-exercises are the same old faces: Anita Cicero, Bill Gates (as always), Johanna Hanefeld, K. Vijay Raghavan, Dr. Mike Ryan, Dr. Mark Dybul (Fauci’s ‘scientific offspring’), Dr. Muhammad Ali Pate (Harvard T.H Chan School of Public Health=Trust and Community-based Zuckerberg’s family Leadership Network), Tom Frieden (CDC and CFR affiliated), Tom Inglesby (JHU, CDC, White House COVID-19 Response Team and Biden-Harris transition team), which indicate a ‘continuation’ of the agenda.
Even here, wasn’t there again a prediction, long time ago, straight out of Hollywood, named Contagion (2011), in the same year the AI purchased Warner Music Group for $3.3 billion and acquired Atlantic, Warner Bros. Records, Rhino, and Warner Music Nashville? The AI stands for “Access Industries” mentioned in: https://www.businessinsider.in/smallbusiness/finance/the-rise-of-billionaire-len-blavatnik-one-of-wall-streets-greatest-dealmakers/slidelist/51143940.cms#slideid=51143944
Right at the begin of Covid19 injections genocide, senate assured that BARDA was awarded $2 billions over four years to prepare against new threats, with the ‘Disease X Act’ in May 2021 at https://www.baldwin.senate.gov/news/press-releases/baldwin-introduces-disease-x-act-to-respond-to-future-viral-outbreaks.
And today, strangesounds.substack.com writer posted a link to newer ‘Disease X Act of 2023’ introduced in Congress (June ‘23) at : https://www.congress.gov/bill/118th-congress/house-bill/3832/text, which wants: “To establish a program at BARDA for developing medical countermeasures for viral threats with pandemic potential.“
So the threats crystallized out, for Senate and Congress now these are: viral threats, again, with reference to the Committee on Energy and Commerce. No ‘health’ institution involved? Others predict that it is going to be a bacterial infection, since the Bifidobacterium modulation in covid19 treatments is a given fact^8.
The fact that nobody until this day is talking consistently about genetic modifications of HUMANS, means that the entire science, health care, MSM, ALL are preventing vulnerable simple people from finding out the truth. AND when you see the BARDA, now approved members of the top ‘health’ HHS agency, with for example, members Renee Wegrzyn’s (https://forward.darpa.mil/presenters/Dr_Renee_Wegrzyn) activities like:
“At DARPA, Wegrzyn leveraged the tools of synthetic biology and gene editing to enhance biosecurity, support the domestic bioeconomy, and thwart biothreats. Wegrzyn received the Superior Public Service Medal for her work and contributions at DARPA”
you need to ask, is that above, the top priority for HHS?? Are the human genes so bad that without gene editing the bio-security would collapse?? There is ONLY SYNTHETIC BIOLOGY path, BIO-security and BIO_economy, there is NOTHING ABOUT NATURAL HUMAN HEALTH HERE in that ironically called ‘HEALTH and HUMAN Services‘ department, being literally the left hand of FDA. Try to search their fiscal budget file for ‘bacteri’ and ‘virus’ at:
https://www.hhs.gov/sites/default/files/fy-2023-phssef-cj.pdf
and check 3 tables on p.188 titled “FY 2023 BARDA ARD Estimate“, “FY 2023 BARDA PBS Estimate” and “Emerging Infectious Diseases”, you will see that the largest amounts of research spending go actually for Rad/Nuc, DRIVe and MCIP and filoviruses (among others, Marburgvirus, Ebolavirus).
Dr. Richard Bartlett just warned (1/19/24) everyone (https://forbiddenknowledgetv.net/americans-being-infected-with-live-ebola-by-secret-bill-gates-project/) that the first Denver Health care workers got vaccinated with the live ERVEBO Ebola vaccine, genetically engineered from VSV stitched with surface glycoprotein of the Zaire strain of Ebola. The package of the FDA 2019 approved injection states: ”The duration of shedding is not known” (https://www.fda.gov/media/133748/download). Among the proudly injected ‘heroic’ shedders of the first live Ebola GMO’s SEEDS in DENVER are Dr. Maria Frank, Capt. Elizabeth Lenz. (https://www.9news.com/article/news/health/denver-health-medical-team-first-ebola-vaccine/73-b3d8f0fd-35a4-4dff-b67b-19e566cb6d6f). The FDA description sheet points to the still not finished clinical trials of the ERVEBO product, which can be found at: https://classic.clinicaltrials.gov/ct2/show/results/NCT02876328. Among the 4789 participants were 15 deaths, so far, 5 in placebo goups(!!), with 3 of them being CHILDREN above 1 year of age, 10 deaths in control goups. The CIMINAL INSANITY of this all is reaching indeed the tip. When searching for patents related to Q05320 the envelope glycoprotein with furin site (sounds similar?) from the EBOV (ebola virus), lot of repeating organizations are popping up: US 6630144-A 2 07-OCT-2003 (Secretary of the Army), US 10849975-B2 (DHHS), US 9597388-B2 2017 (The Trustees of the University of Pennslyvania, location of Biden’s Center), US 9097713-B2 2015 (SECRETARY OF THE ARMY ON BEHALF OF USAMRMC), US 10160795-B2 15 25-DEC-2018 (DHHS+Secretary of the Army and Humabs BioMed SA). And countless more, almost all for vaccines, neutralizing anti-bodies or monoclonal anti-bodies. What an amazing collection of military applications, all based on molecular biology... Just wonder if the Denver airport will be the first one to screen for Ebola right next to its colorful murals? Strange Sounds pointed today to this OLD Ebola outbreak prediction in 2014 by a very well informed journalist, Harry Vox:
Harry pointed in his interview to the 2012 CDC Ebola virus patent for “Human Ebola Virus Species and Compositions and Methods Thereof“ https://patents.google.com/patent/US20120251502A1/en
To close this part here, if there is one person to ask more about viruses, it would be not Dr. Fauci, but the founder of METABIOTA, Dr. Nathan D. Wolfe, currently at Stanford and other places, including the famous Edge.org club (now without Jeffrey Epstein). A good piece of this story was covered by another s-s writer:
who also pointed to this original old article at: https://expose-news.com/2022/04/13/who-is-the-virus-hunter-dr-nathan-wolfe/
"Disease X" Is Scheduled for Discussion (January 17th) at Davos. This needs to be watched, carefully. But not everything, that can be left out, for now:
https://twitter.com/JackStr42679640/status/1747562775415792120
Internet is and was full of speculations, ever since the covid19 ‘PLAN’demic’ start, for example, one of it was analyzed already 1.5 years ago:
2017 SPARS scenario and the 2020 SARS-CoV-2 Spike reality with Monkeypox opportunities.
Update: 6/24/2022 New insight into most recent Monkeypox publication. Urgent update: 6/30/2022 Smallpox (Jynneos) MVA-BN vaccine and SPIKE overlap! (is it Bavarian Nordic or actually Pfizer, again???)Thanks for reading mejbcart’s Newsletter! Subscribe for free to receive new posts and support my work.
The current agenda announcement: “Davos 2024: Who's coming and what to expect“ at https://www.weforum.org/agenda/2023/12/davos-2024-what-to-expect-and-whos-coming/ , indicates again, the presence of the same cabal: https://www.weforum.org/agenda/2024/01/how-to-follow-the-annual-meeting-2024/ and only proves that in the last 4 YEARS most people DID NOTHING to stop globally the real CRIMINALS even after the obvious covid19 crimes. Imagine billions would do this:
https://twitter.com/damonimani/status/1747388354587463766
Dr. David Martin^5 always points to the political arena and its importance in the preparations for the future. His newest revelation, no votes for: Vivek Ramaswamy the 24’ presidential candidate “America First 2.0.” who bought out substantial parts of the Arbutus company developing nanomaterials, later on used in the Mod_E-RNA covid19 injections production (https://endpts.com/vivek-ramaswamy-is-diving-into-rna-launching-a-new-biotech-with-arbutus-and-a-team-of-vets/). It is known that Mod-E-RNA prepares for new mod mRNA revolution connected with everything related to side effects of covid-19 genetically modifying injections, so is there any ‘priming’ of the new Diesease X by the old coronaviruses, with their new SYNTHETIC parts coming all but from one source, the covid19 genetic material injections? It appears, that the most recent Disease-X MSM campaign is grounding the new fear on ONE recent publication, mentioned by John Campbell, the widely known nurse educator in his short talk : “Disease X” Has a 100% Fatality Rate in Humanized Mice” at https://forbiddenknowledgetv.net/disease-x-has-a-100-fatality-rate-in-humanized-mice/
It is about a new chinese study titled “Lethal Infection of Human ACE2-Transgenic Mice Caused by SARS-CoV-2-related Pangolin Coronavirus GX_P2V(short_3UTR)“ ( https://www.biorxiv.org/content/10.1101/2024.01.03.574008v1.full ).
What does its abstract say? Quote: “We found that the GX_P2V(short_3UTR)23 clone can infect hACE2 mice, with high viral loads detected in both lung and brain tissues. This infection resulted in 100% mortality in the hACE2 mice. We surmise that the cause of death may be linked to the occurrence of late brain infection.“
That’s the ONLY study saying this, the end of this short article points to: “Our findings are evidently inconsistent with those of Zhengli Shi et al. (5), who tested the virulence of GX_P2V in two different hACE2 mouse models.” In addition, the authors say:
“our hACE2 mouse model may be relatively unique.“
this hACE2 mouse model highly expresses the hACE2 in the mouse brain
hACE2 mice have abnormal physiology, with relatively reduced serum triglyceride, cholesterol, and lipase levels, compared to those of wild-type C57BL/6J mice.
Despite of all of this, the chinese scientists conclude “their study offers a distinct alternative model for understanding the pathogenic mechanisms of SARS-CoV-2-related coronaviruses.“
If you have a genetically modified abnormal mouse already and apply on it apparent viruses binding exactly to the vital for their survival tissues, but engineered in a way to bind these ‘foreign invaders’, what would you expect? That 100% mortality of the ‘humanized mice’, expressing human ACE2 (hACE2) in just 7-8 days after the injection, was proceeded by up to 10% decrease in body weight, piloerection, hunched posture, sluggish movements, and their eyes turned white.
How all the researchers can even look into the eyes of the tortured mice? Now, they CAN’T! A mice without BARDA wellness testing such as lipids, hormones and metabolics provided by their DRIVe and the Medical Countermeasures Innovation Partner (MCIP), should be eliminated from experimentation. Why not testing on healthy mice, with its own unmodified ACE2 receptors? To get into the RT-qPCR tests performed on the hemogenized mix of infected tissue is another issue but then searching for the N gene copy numbers (the one most common for all corona viruses) while using 40 cycles (15 sec at 95°C and 1 min at 60°C) is just ridiculous, the same fraud as during covid19.. Last but not least, doesn’t pentobarbital, used in this experiment before infection on all animals, affect their brains too?
Let’s see how the most infectious part of this ‘new threat’ compares with the old one, Spike2020, from the covid19 genetically modifying injections.
Below is the bioinformatics based BLAST (NIH software) Spike comparison of SARS-CoV-2 with the Spike from the studied pangolin coronavirus GX_P2V (https://www.ncbi.nlm.nih.gov/nuccore/2044015426), both sharing 92.3% IDENTITY in their amino acid sequence, with their C-terminal S2 domains being 100% IDENTICAL. The largest difference is the furin site which is entirely MISSING in the pangolin version of the Spike(QVT76606.1) in Query line, and SARS-CoV2 Spike in Sbjct:
Query 1 MFVFLFVLPLVSSQCVNLTTRTGIPPGYTNSSTRGVYYPDKVFRSSILHLTQDLFLPFFS 60
MFVFL +LPLVSSQCVNLTTRT +PP YTNS TRGVYYPDKVFRSS+LH TQDLFLPFFS
Sbjct 1 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS 60
Query 61 NVTWFNTIHLNYQGGFKKFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDARTQSLLIV
NVTWF+ IH++ G K+FDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLD++TQSLLIV
Sbjct 61 NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV
Query121 NNATNVVIKVCEFQFCTDPFLGVYYHNNNKTWVENEFRVYSSANNCTFEYISQPFLMDLE
NNATNVVIKVCEFQFC DPFLGVYYH NNK+W+E+EFRVYSSANNCTFEY+SQPFLMDLE
Sbjct121 NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE
Query181 GKQGNFKNLREFVFKNVDGYFKIYSKHTPIDLVRDLPRGFAALEPLVDLPIGINITRFQT
GKQGNFKNLREFVFKN+DGYFKIYSKHTPI+LVRDLP+GF+ALEPLVDLPIGINITRFQT
Sbjct181 GKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT
Query241 LLALHRSYLTPGKLESGWTTGAAAYYVGYLQQRTFLLSYNQNGTITDAVDCSLDPLSETK
LLALHRSYLTPG SGWT GAAAYYVGYLQ RTFLL YN+NGTITDAVDC+LDPLSETK
Sbjct241 LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK
Query301 CTLKSLTVEKGIYQTSNFRVQPTISIVRFPNITNLCPFGEVFNASKFASVYAWNRKRISN
CTLKS TVEKGIYQTSNFRVQPT SIVRFPNITNLCPFGEVFNA++FASVYAWNRKRISN
Sbjct301 CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISN
Query361 CVADYSVLYNSTSFSTFKCYGVSPTKLNDLCFTNVYADSFVVKGDEVRQIAPGQTGVIAD
CVADYSVLYNS SFSTFKCYGVSPTKLNDLCFTNVYADSFV++GDEVRQIAPGQTG IAD
Sbjct361 CVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIAD
Query421 YNYKLPDDFTGCVIAWNSVKQDALTGGNYGYLYRLFRKSKLKPFERDISTEIYQAGSTPC
YNYKLPDDFTGCVIAWNS D+ GGNY YLYRLFRKS LKPFERDISTEIYQAGSTPC
Sbjct421 YNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC
Query481 NGQVGLNCYYPLERYGFHPTTGVNYQPFRVVVLSFELLNGPATVCGPKLSTTLVKDKCVN
NG G NCY+PL+ YGF PT GV YQP+RVVVLSFELL+ PATVCGPK ST LVK+KCVN
Sbjct481 NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVN
Query541 FNFNGLTGTGVLTTSKKQFLPFQQFGRDISDTTDAVRDPQTLEILDITPCSFGGVSVITP
FNFNGLTGTGVLT S K+FLPFQQFGRDI+DTTDAVRDPQTLEILDITPCSFGGVSVITP
Sbjct541 FNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP
Query601 GTNTSNQVAVLYQDVNCTEVPMAIHAEQLTPAWRVYSAGANVFQTRAGCLVGAEHVNNSY
GTNTSNQVAVLYQDVNCTEVP+AIHA+QLTP WRVYS G+NVFQTRAGCL+GAEHVNNSY
Sbjct601 GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSY
Query661 ECDIPVGAGICASYHSMSS----FRSVNQRSIIAYTMSLGAENSVAYSNNSIAIPTNFTI
ECDIP+GAGICASY + ++ RSV +SIIAYTMSLGAENSVAYSNNSIAIPTNFTI
Sbjct661 ECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTI 720
After 4 years of exposure to all sorts of Spikes, is there one person who wouldn’t have a single protecting antibody against the Goliath, no matter to which section of the above or of the not even shown IDENTICAL C-terminal section with additional ~400 residues? Last but not least, what do we have in common with the genetically modified hACE2 mice??
What is known about the ACE2 gene situated on the SEX X-chromosome at Xp22.2 ^7 and expressing ACE2 receptor? People surely know this, if not all, so here small piece from the abstract^6:
“Cardiovascular diseases are predicted to be the most common cause of death worldwide by 2020. Here we show that angiotensin-converting enzyme 2 (ace2) maps to a defined quantitative trait locus (QTL) on the X chromosome in three different rat models of hypertension. In all hypertensive rat strains, ACE2 messenger RNA and protein expression were markedly reduced, suggesting that ace2 is a candidate gene for this QTL.“
further:
“Targeted disruption of ACE2 in mice results in a severe cardiac contractility defect, increased angiotensin II levels, and upregulation of hypoxia-induced genes in the heart. Genetic ablation of ACE on an ACE2 mutant background completely rescues the cardiac phenotype. But disruption of ACER, a Drosophila ACE2 homologue, results in a severe defect of heart morphogenesis. These genetic data for ACE2 show that it is an essential regulator of heart function in vivo.“
Every single covid19 injection caring the genetic sequence of the Spike, which then binds ACE2, will end up with disregulating that entire pathway, not even talking about the genetic effects on that X22.2 gene.
Thus STOP TAKING, PRODUCING, SPREADING of the GENETICALLY MODIFYING contents of covid19 injections, STOP the FEAR and do something against it all, the driving cabal in particular.
Thank You for your attention, reading and hopefully some comments;))
The update for 1/21/24 is in regard to big news:”A brain-dead man was attached to a gene-edited pig liver for three days” to read at : https://www.technologyreview.com/2024/01/18/1086791/brain-dead-man-gene-edited-pig-liver/ Few citations from the article, quote: “During the experiment, the pig liver was mounted into a device from the company OrganOx that is normally used to keep donated human organs warm and perfused with blood so they will be available for transplant longer.“ and “According to eGenesis, its liver, which came from a genetically modified Yucatan minipig, was still healthy even after three days.“ No mentions what happened after, did the man wake up??? The picture of the pig opening the pathway to the merger of animals with humans can be seen at the end of that article and it looks as dehumanzing as possible, to take your last piece of HUMAN DIGNITY away. In the meantime, the next post will be about a ‘drug’, straight out of the human body, which regenerates the livers, within an astonishingly short period of time. Stay tuned;))
More Davos ‘24 video’s:
Strange Sounds posted links to couple of sessions, including the ‘new pandemic’:
Literature.
Mod-E-RNA, cancers and Programmed cell Death Protein 1 pathway (PD-1/PD-L1). And who is Len Blavatnik?
Thank You for reading and your attention. For readers who unsubscribe, please, let me know why? Or maybe it is Sub-stack, who regulates the number of ‘allowable’ subscribers for writers who do not request MONEY for their work… ? Cor-por-at-I-on. Updates first, the main post is under the divider bar.
https://report24.news/dieser-professor-erklaert-weshalb-gendertheorie-irrlehre-eines-paedophilen-ist/ The ‘gender identity’ issue is solved in the moment of CONCEPTION, and puberty only fine tunes that ‘moment of origin’.
Janssen, Diederik (2017). "John Money's "Chronophilia": Untimely Sex between Philias and Phylisms". Sexual Offender Treatment. 12 (1).
Michael A Crackower et al. “Angiotensin-converting enzyme 2 is an essential regulator of heart function“ Nature. 2002 Jun 20;417(6891):822-8. https://pubmed.ncbi.nlm.nih.gov/12075344/ with quote from abstract:
Ekta Shirbhate et al. “Understanding the role of ACE-2 receptor in pathogenesis of COVID-19 disease: a potential approach for therapeutic intervention“ Pharmacol Rep. 2021; 73(6): 1539–1550. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8236094/
Clarissa Reginato Taufer & Pabulo Henrique Rampelotto “The Role of Bifidobacterium in COVID-19: A Systematic Review“ Life 2023, 13, 1847. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10532519/pdf/life-13-01847.pdf
Evangelos Tsiambas et al. “Chromosome X riddle in SARS-CoV-2 (COVID-19) - related lung pathology”. Pathol Oncol Res. 2020 Oct; 26(4): 2839–2841. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7370877/ with a quote: “According to the latest published epidemiologic data, SARS-CoV-2-mediated COVID-19 pandemic demonstrates aggressive clinic-pathological profiles in significant subsets of the infected patients –especially in males- and for this reason the role of chromosome X that hosts the hACE2 gene (band Xp22.2) seem to be critical.“
The link was provided by the kind reader Papillon (in the comments section):
Sebok K. Halder et al. “The importance of laminin at the blood-brain barrier“ Neural Regen Res. 2023 Dec; 18(12): 2557–2563. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10358660/
Bill Gates, raunchy rancher
The plan? slo-poison us!
https://scientificprogress.substack.com/p/bill-gates-raunchy-rancher
Why is food poisoning legal?
How Rumsfeld forced the approval of Aspartame.
Artificial sweeteners, MSG, PFAS, Glyphosate ... go organic!
https://scientificprogress.substack.com/p/why-is-food-poisoning-legal
War on food
https://scientificprogress.substack.com/p/war-on-food
Water poisoning
https://scientificprogress.substack.com/p/water-poisoning-they-drink-perrier
Not fast food, PFAS food:
https://scientificprogress.substack.com/p/fast-food-or-pfas-food
War on poultry and cattle:
https://scientificprogress.substack.com/p/war-on-poultry
What if X stands for laminin too...The cross shape protein which literally holds us together (in a biological sense)....:)
Anyway, since the first time in history the "countermeasures" started, more sicker the population is and more deseases appeared, so no mistery about any x. And it can not be a fight with law and democracy against these psychopaths who have no laws and democracy.