The white clots after the genetically modifying covid injections. Is it the -KV- to -PP- mutation, Fibrin/-ogen, or all of it?

Update 5/22/2024: Great discussion with the right language: https://uncutnews.ch/haeufigkeit-von-blutgerinnseln-steigt-radiologe-sieht-taeglich-alarmierende-befunde/

Update 4/8/2024: A ‘STRONG’ multinational team from UCLA/Stanford/University of North Carolina at Chapel Hill(!), Harvard and UK comes up with a publication https://www.pnas.org/doi/epdf/10.1073/pnas.2300644120 which ‘explains’ indirectly the non-digestable peptides which apparently are coming from viral fragments and affect the following ‘infection’, leading to cloths like no other coronaviruses.. Any comparison of these peptides with other coronaviruses? No, NONE. NO WORD about covid genetically modifying injections and the fact that the REAL onslaught of these fragments, which btw. are very conserved among the old and new corona viruses, comes from genetically modifying injections!!! Who participates? Specialists from places which came up with the covid injections and the SAX team from SSRL lab in Stanford. What an inconvenient bunch of LIES in a GLOBAL TRAGEDY. Few more FACTS about these fragments at the end of this post.

Update 3/2/2024: Heavy metal detox (including calcification being part of the clots ) presented in https://go2.thetruthaboutcancer.com/eastern-medicine/episode-3/ patent US6720356B2 with more details at the end of the post

Update 3/1/2024: Can’t respond to readers comments any more! SS, stands for sub-stack, backwards on two sections: bus-kcats, oh really???

Update 2/29/2024: New canadian study “Genome-wide enhancer-associated tandem repeats are expanded in cardiomyopathy“ at https://www.thelancet.com/action/showPdf?pii=S2352-3964%2824%2900062-8 . A mention about sudden cardiac death in childhood and the performed whole genome analysis (NOW AFTER covid mod mRNA gene therapies on everybody!!!?) showed a rare tandem repeat expansions of CGG leading to the diseases.. How many CGG’s are in the Spike genome injected into billions, including children? Quick count: 5 at least..

---

The white clots in human bodies, MUST be seen by countless medical doctors investigating blood of their patients, surgeons cutting human bodies every day, embalmers dealing with deceased bodies, but still, except for the ‘Died suddenly’ documentary and the few new heroes on that intensifying topic, there are many questions left. The most important message here, about REMEDIES to this catastrophe, is at the very end of this post.

The 2/22/2024 Highwire episode 360 “The clot thickens” presents an interview with people researching the white clots in veins and arteries, including Dr. R. Cole, embalmer R. Hirschman and Thomas Haviland MSc., starting at ~1:16:45:

https://www.bitchute.com/video/0W0uyXi01JTl/

Here it needs to be added, this is NOT a promotion of Highwire, which until this day is following FDA redefinition rule, and like all MD’s, when talking about covid injections, illegally calls them ‘vaccines’.

The white clots were not quite there yet in 2020, when the SARS-CoV-2 was apparently ‘already killing countless victims’, since according to most of the embalmers’ testimonies, the clots came with the covid genetically modifying injections, ~6 months into 2021. The difference in the 2020 natural Spike from the SARS-CoV-2 (official NIH entry ever since 2020) and the Spike from the injections is the SYNTHETIC gene encoding it, which contains 2 mutations, making the final by ribosomes expressed Spike ‘stabilized’ in the cells membranes. That happens in all cells membranes crossed by the accompanying synthetic LIPID-nanos. Once again, a reminder, natural infection is caused by the SARS-CoV-2 Spike PROTEINS coming from OUTSIDE of the cells, from EXTERNAL sources proceeding the apparent integration of viral genetic RNA material. Covid genetically modifying injections, reverse that, they produce the synthetic, MODified SPIKE PROTEIN INSIDE of ALL ACCESSIBLE CELLS, not on the MUCUS on external surface of only specific tissues carrying the ACE2 receptor. The MANDATED (!!!) injected Spike protein production is only followed by GENETIC INTEGRATION FIRST, before any anti-body response can happen, which always, can only happen in the blood. The only virus reaching blood directly is Rabbies. Thus injection of viral, toxic, non-human Spike DIRECTLY INTO BLOOD, has to be called REPROGRAMMING of the human body for a synthetic immune response, that’s called gene modification treatment, or ‘gene therapy’. Here a short article titled:

"mRNA: Fulfilling the Promise of Gene Therapy"

by Drew Weissman1 dreww@upenn.edu and Katalin Karikó2 katalin.kariko@biontech.de from:

https://www.cell.com/molecular-therapy-family/molecular-therapy/fulltext/S1525-0016(16)30267-2 That’s where they addmited the truth, which later on was totally derailed by the very same people and everybody else: “a realization crucial to the rapid development of the life-saving mRNA COVID-19 vaccines(???) during the deadly pandemic.“ from https://arstechnica.com/health/2023/10/after-being-demoted-and-forced-to-retire-mrna-researcher-wins-nobel/

So how about about this simplest clots explanation scenario, among many, so far:

the synthetic, patented genetic CODE for the Spike, which ‘in ALL COVID-19 vaccines in the US encodes spike with K986P/V987P mutations to stabilize its prefusion conformation’^1 in all by nanos crossed membranes, that SYNTHETIC, NON-HUMAN Spike stays in the membranes of many tissues, but in particular inside of blood vessels, with constant motion, a flow, for long enough, narrowing them down, blocking the passages with sheer forces acting on blood while supporting its '‘phase separation’, build up from fibrin, platelets, binding to metals floating nearby, in particular Ca2+ deposits (that’s the color and hardness). Remember, the biggest amount of blood vessels, carrying oxygen, is in the BRAIN.

This process would NOT start if it was the natural ‘non-stabilized’ membrane Spike in 2020, not only because the VIRAL Spike always comes from OUTSIDE of the blood vessels, but also, because many embalmers do confirm the fact that 2020 was not the year of excessive clots, in particular thanks to (the worldwide responses) hard work of Thomas Haviland MSc:

Latest Research Findings on Embalmers Strange Clots

What happens to the blood when sheer forces are applied to it? The best answer to that comes from a biological dental office* applying a new healing technology called PRF (Platelet Rich Fibrin)^2 based on a phase separation due to differences in molecular weight in rotational motion, explained at: https://decisionsindentistry.com/article/applications-platelet-rich-fibrin-dentistry/

How do the fibrin clots look like when one trims the Platelet Rich Fibrin (PRF) membrane portion of the centrifuged blood, rich in stem cells, growth factors? Fig 4A from that PRF article:

and that’s what Msc Haviland show, and many saw it in ‘Died Suddenly’:

There are some clear differences in the 2 clots pictures above, but what the North Carolina at Chapel Hill writes in 2022 about the “Fibrinogen, Fibrin, and Fibrin Degradation Products in COVID-19“ (https://pubmed.ncbi.nlm.nih.gov/36029073/), which are the same clots? That’s the UNC, (employing also Ralf Baric) Blood Research Center from the same NCH who has the patent for MOD-E-RNA injections. Their summaries of the autopsies say, quote:

• ”Fibrin-rich deposits have also been reported in cardiac tissue both coincident with and independent from evidence of myocarditis [60, 61]”

• Fibrinogen, fibrin deposition in intravascular and extravascular compartments,

  and FDPs all appear to be biomarkers of severe COVID-19 as well as active players in pathogenic mechanisms, leading to poor patient outcomes.

• additional studies are required to define the causative mechanisms by which perturbations in fibrinogen, fibrin, and fibrinolytic pathways contribute to acute disease and the increasingly prevalent ‘long COVID’ !!!!!!!

• Indeed, a fundamental understanding of the contribution of fibrinogen to parental SARS-CoV-2 will likely provide a significant benefit in defining the pathophysiology of new SARS-CoV-2 variants as well as completely new coronaviruses that emerge in the human population.

There is NOT A SINGLE WORD ABOUT covid genetically modifying injections (completely deceptively called ‘vaccines’ everywhere) expressing the patented Spike -PP- version which sits for nobody knows how long in membranes of all organs, blood vessels, etc. , wherever the nanoparticles reached their goal, not to mention binding of sugars, ligands while equally binding to degraded, misfolded own fragments or even the genetic aspect of the synthetic mod mRNA genes themselves. This paper was supported by a grant from the National Institutes of Health and National Heart Lung Blood Institute(R01 HL160046)... How convenient for NIH, which now cashes MILLIONS of $ for patents (co-owned by MODeRNA) on the genetically modifying injections!!!! And there was another 2021 study, titled “Characterization of the ‘White’ Appearing Clots that Cause Acute Ischemic Stroke“ (Journal of Stroke and Cerebrovascular Diseases, Vol. 30, No. 12 (December), 2021: 10612), claiming the same platelets and fibrin involvement. But it is not only min stream MSM-based science, even the study published by experts like Dr.McCullough et al. titled “A Systematic Review of Autopsy Findings in Deaths after COVID-19 Vaccination“ does not touch the clots in a single word!!! The link to this study comes from todays CHD article at:
https://childrenshealthdefense.org/defender/cureus-retracts-study-critiquing-covid-19-vaccine-censorship/, describing yet another retracted study which is not spending a single sentence on this issue.

Note, both first 2 MSM-based studies are NOT from 2020, but from the same time the embalmers start to raise voices about the issue. The only difference is, embalmers talk about ‘vaccines’, the official ‘science’ (which these days should change its name to sci-fi) about SARS-CoV-2 infections, not mentioning the covid injections at all, for clear reasons, a total GAG order by the gov!!

Here is a blast form the past, about fibrin, discovered in 1666…:

The entire ‘modern mad-I-Sin-e’ is in a complete cover up of every single aspect of the covid, whether short or long, with not a single serious, proper study devoted to looking at the differences between the -KV- and -PP- forms of the toxic, synthetic Spikes. Maybe because it would also imply how many actually have the natural -KV- form….

This would also explain why all the geneticists, even the ones testifying in Senates, who still do work for medical cartels, will NOT SEQUENCE THE DIFFERENT SPIKES IN HUMAN BODIES. The very first SARS-CoV2 variant had just one single amino acid difference and yet, the entire dipeptide change -KV- to -PP- is suddenly forgotten??

What are the 3D SARS-CoV0-2 Spike crystallographic structures out there and do they point to maybe more than saying that the -PP- Spike version is the ‘prefusion’ version sitting in the membranes in much more stable way? In this study https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9109970/ titled “Multifaceted membrane binding head of the SARS-CoV-2 spike protein“ there is a complete mixture of the 'natural -KV- and the artificial -PP- Spike mutants, for example:

6xlu, 7jwy, 6zge, 6zow, 6xm3 has the ‘SRLD-PP-EAEVQI’ modified sequence , and equally the 7jwy, 6zge, 6zow and 6xm3 all are the Spikes with -PP-mutation, except the natural forms in the Pdb Data Bank at https://www.rcsb.org/fasta/entry/6XRA , 6ZB4 , 6XR8, 6ZB5. Why are researchers mixing synthetic Spikes with natural version when they supposedly do research on natural infection only???

This part of their abstract is a total fall into a self inflicted net of questions: ”In contrast, all antibodies that target the spike head would block the membrane docking process that precedes ACE2 recognition. Together this illuminates the engagements of the spike protein with plasma, endocytic, ER or exocytic vesicle membranes that help to drive the cycle of viral infection, and offers novel sites for intervention.”

Emailing the senior author of this work and asking for an explanation, ended with no response from the Dep. of Biochemistry, University of Alberta, Edmonton, Canada..

Let’s switch to the fibrin-/-ogen issue of the blood, in particular the MODeRNA involvement.

How much Mod-E-RNA is valuing the human genome while hacking the programmable, NOW DIGITAL biology was wonderfully admitted by its cooking Chef of the Flagship Pioneering and CEO & Moderna Co-founder Dr. Noubar Afeyan | Spotlight | Code 2022 on youtube, oh video does not exist, anymore…. Well, this link gives some info on it: https://www.fiercebiotech.com/biotech/shots-goal-to-deterministic-drug-development-flagship-ceo-moderna-chair-noubar-afeyan-pens

And while MODeRNA was essential in starting the genetic attack, the industry flows with it, so look at the newest Pfizer Seagen purchase, which is all about: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9658517/ peptide drug conjugates, the future of ‘med-i-Sin-e’, ALL looking like a Spike based connection of homing peptides, linkers and payloads, ALL originating from Spike, mind you, the injected and embedded one. You connect the new drug to whatever human part the Spike docked to, and you will get your cancer fixed, apparently. Not only there is fight for who has the rights to the new future https://www.jdsupra.com/legalnews/ptab-issues-final-written-decision-3424933/

but the fact, that https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10452662/ Spike might be in every cancer tissue, possibly implies, that Bourla might be right saying every 3rd person on this planet will get a cancer in 2025…

---

Now to 866 aa’s long fibrin, https://www.uniprot.org/uniprotkb/P02671/entry with following features, binding a LOT of calcium:

Site 35-36`Cleavage; by thrombin; to release fibrinopeptide A ( at residues ‘RG‘)

Site 100-101`Cleavage; by plasmin; to break down fibrin clots (residues ‘KD’)

Site 121-122`Cleavage; by hementin; to prevent blood coagulation (residues ‘NN’)

Site 123-124`Cleavage; by plasmin; to break down fibrin clots (residues ‘RD’)

Binding site 791 Ca²⁺ (UniProtKB | ChEBI)

Binding site 793 Ca²⁺ (UniProtKB | ChEBI)

Binding site 795 Ca²⁺ (UniProtKB | ChEBI)

Binding site 797 Ca²⁺ (UniProtKB | ChEBI)

that section binding Ca+2 around the 781-800, with the specific residues binding the Calcium 791-793-795-797 D*aD*qW*eE* has its sequence:

NN←>MQFSTFDR<→D-A-D-Q-WEENCA

You see what happens when hementin cuts at ‘NN’, and further plasmin cuts at ‘RD’? The calcium looses their bonding partners, the entire net of amino acids holding calcium in place inside of the protein falls apart, the calcium goes free and accumulates. Btw. most of the digestive enzymes in general involve the smallest dipole moment out there, a pair of positive-negative residues, i.e. Arg-Asp=RD, or KD. This is like a micro knife, way better than graphene, which also cuts into all proteins and genetic material like RNA, DNA, the difference is graphene does it non-specifically, anywhere, anytime, unpredictable.

How ironic that Ca2+ fibrin section is encoded by ‘DADQWEEN’…. The one from UK with MEROPS digestive enzymes data base, owned by the Welcome Trust???

Direct comparison of the 866 residues long fibrin code P02671, with Spike (YP_009724390.1) has ~30% identities (Query line is fibrin, Sbjct is Spike2020):

20-35 Fibrinopeptide, nowhere to find by BLAST, so by hand
 ADS--GEGDFLAEGGG--VR    fibrin
PGDSSSG---WTAGAAAYYVGYL  Spike

here what BLAST comes out with:
Query  310  PGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQN  348
            PG +G      +K      G   +WNS +  +   GN N
Sbjct  412  PGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN  450
                                          *<=glycosylation
Query  424   TRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGP-----DGHKEV  478
             T+R ++  +++T+  D    +G   V  G            V  TV  P     D  KE 
Sbjct  1105  TQRNFYEPQIITT--DNTFVSGNCDVVIG-----------IVNNTVYDPLQPELDSFKEE  1151
Query  479   TKEVVTSEDGSDCPEAMDLGTLSGI  503
               +   +    D    +DLG +SGI
Sbjct  1152  LDKYFKNHTSPD----VDLGDISGI  1172

Query  59   DWNYKCP---SGCRM  70
            D+NYK P   +GC +
Sbjct  420  DYNYKLPDDFTGCVI  434

and this is just mindblowing: FRAGMENT from S1 N-terminal portion, THE MOST DIFFERENT to all previous old corona Spikes, must be 'bat's fresh cloning':

Query  95   YQKNNKDSHSLTTNIMEILRGDFSSANNRDNTYNRVSEDLRSRIE-------VLKRKVIE  147
            Y KNNK       + ME     +SSANN   T+  VS+     +E        L+  V +
Sbjct  145  YHKNNK-------SWMESEFRVYSSANN--CTFEYVSQPFLMDLEGKQGNFKNLREFVFK  195
and continued with the sequence:
Query  148  KVQ-HIQLLQKNVRAQLV-DMKR----LE--VDIDIKIRSCRGSCSRALAR  190
             +  + ++  K+    LV D+ +    LE  VD+ I I   R     AL R
Sbjct  196  NIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHR  246
BLAST puts no C-terminal section like, so here by hand:
        * * * - *
NNMQFSTFDRDADQWEENCA  fibrin
       FD + D   E
SCGSCCKFD-EDDS--EPVLKGVKLHYT spike C-terminal

BLAST aligns different portion instead, the ACE2 binding part of Spike:
                  ====>   *digestion of the 'DADQWEEN' aligns with ACE2 binding    
Query  777  YTSHNNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYE  836
            Y          F+RD         E+Y  G     C        Y+P  SY       ++
Sbjct  453  YRLFRKSNLKPFERDIS------TEIYQAG--STPCNGVEGFNCYFPLQSYG------FQ  498
Query  837  IENGVVWVSFR  847
              NGV +  +R
Sbjct  499  PTNGVGYQPYR  509

take that fibrinogen portion 95-147 so similar to Spike, with the RGD integrin motif in it(!!) : YQKNNKDSHSLTTNIMEILRGDFSSANNRDNTYNRVSEDLRSRIEVLKRKVIE

 SHSLTTNIMEILRGDF--SSA-NNRDNTYNRVS  FIBRINOGEN
           ++RGD     A ++   +       <<=IDENTITIES
 CFTNVYADSFVIRGDEVRQIAPGQTGKIAD     Spike RGD fragment

and search for PATENTED proteins containing that fibrinogen section, 100% of can be found in MANY patented items, among others for example:

• nano-recombinant fibrinogen for fibrin sealants Patent: US 9381232-B2 5 05-JUL-2016; BAE Systems Information and Electronic Systems Integration Inc.; NH

• Regulated biocircuit systems. Patent: US 11446398-B2 31796 20-SEP-2022 OBSIDIAN THERAPEUTICS, INC.; Cambridge, MA

• AKX87622 289 aa PAT 13-AUG-2015 DEFINITION Sequence 973 from patent US 8999380. Modified polynucleotides for the production of biologics and proteins associated with human diseases. Patent: US 8999380-B2 973 07-APR-2015; Moderna Therapeutics, Inc.; Cambridge, MA

Let’s stop here. Forgive the sidewalk through this 2013 filed MODeRNA 411 pages long patent, which is NOT searchable any more, because of putting out pictures version of the file!!! Some important contents from it, between the divider bars below:

---

Patents mentions proteins like FactorIX, expression of VEGF with PSEUDO-U(!), VEGF with N1-methyl-Pseudo-U (the one in INJECTIONS), GCSF, hAPO-A1, plasminogen in HeLA cells, GALT, ASL (50kd), TAT (50kd), GBE (70kd), ProTHROMBIN, CLP (148kd), TGF-beta1, OTC (40kd), LDLR IgG, hFactorXI, FactorVII, Insulin Glargine/Aspart/Lispro/GluLisine, Tissue Factor, Human Growth Hormone, Human Erythropoietin, Lisosomal Acid Lipase, Glucocerebrosidase (59.7kd), Luciferase (60.7 kD), FactorVIII (for all U’s, natural, Pseudo and N1-methyl-pseudo).

BLAST searches on >600 CHOSEN proteins as admitted by ModeRNA are: “Default parameters in the BLAST algorithm include, for example, an expect threshold of 10, Word size of 28, Match/Mismatch Scores 1, −2, Gap costs Linear. Any filter can be applied as well as a selection for species specific repeats, e.g., Homo sapiens.“, and that’s NOT WHAT NIH pages are offering as ‘DEFAULT’ in their BLAST, you get x1000 LESS sensitivity in search for identities/similarities! That’s a total NIH deception, but not for military protected MODeRNA patent files using very different BLAST then researchers at NIH!!!

Admission of variant possibilities: “Such a library may contain 10, 10², 10³, 10⁴, 10⁵, 10⁶, 10⁷, 10⁸, 10⁹, or over 10⁹ possible variants (including, but not limited to, substitutions, deletions of one or more residues, and insertion of one or more residues).“ ===> Long way to go variants!

Anti-viral polypeptide comprises or consists of from about 6 to about 100 amino acids, e.g., from about 6 to about 75 amino acids, about 6 to about 50 amino acids, about 6 to about 25 amino acids AND “ the anti-viral polypeptide is cytotoxic to a bacterium, fungus, protozoan, parasite, prion or a combination thereof. In certain embodiments, the anti-viral polypeptide is cytostatic and cytotoxic to a bacterium, fungus, protozoan, parasite, prion, or a combination thereof.” AND “the anti-viral polypeptide is cytostatic to a tumor or cancer cell (e.g., a human cancer cell).“

Genetic DETAILS: They harbor signatures like Kozak sequences which are commonly known to be involved in the process by which the ribosome initiates translation of many genes. Kozak sequences have the consensus CCR(A/G)CCAUGG, where R is a purine (adenine or guanine) three bases upstream of the start codon (AUG), which is followed by another ‘G’. 5′UTR also have been known to form secondary structures which are involved in elongation factor binding.

One paragraph is worth mentioning: ‘5′ UTR and Translation Initiation’ which points to the CONTROLLABLE PROGRAMMING OF HUMAN TISSUE: “For example, introduction of 5′ UTR of liver-expressed mRNA, such as albumin, serum amyloid A, Apolipoprotein A/B/E, transferrin, alpha fetoprotein, erythropoietin, or Factor VIII, could be used to enhance expression of a nucleic acid molecule, such as a mRNA, in hepatic cell lines or liver. Likewise, use of 5′ UTR from other tissue-specific mRNA to improve expression in that tissue is possible for muscle (MyoD, Myosin, Myoglobin, Myogenin, Herculin), for endothelial cells (Tie-1, CD36), for myeloid cells (C/EBP, AML1, G-CSF, GM-CSF, CD11b, MSR, Fr-1, i-NOS), for leukocytes (CD45, CD18), for adipose tissue (CD36, GLUT4, ACRP30, adiponectin) and for lung epithelial cells (SP-A/B/C/D).“

---

Let’s look at that SERUM AMYLOID A (SAA1) , expressed in liver upon cytokine stimulation, with description at: https://www.uniprot.org/uniprotkb/P0DJI8/entry , which describes its subcomponents (the reduction into pieces so much liked by molecular biologists then playing God, while living with an illusion they can ever be better in Creation…):

Region19-45 Important for amyloid formation; forms amyloid fibrils in vitro. Here its entire sequence:

MKLLTGLVFCSLVLGVSS—SIGNAL-

RSFFSFLGEAFDGARDMWRAYSDMREA— fragment responsible for amyloids formation and the rest:

NYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY

whereby AANEWGRSGKDPNHFRPAGLPEKY is cleaved upon amyloid formation.

and here some of its BLAST comparisons outputs, with NIH default parameters, only:

Query  13   VLGVSSRSFFSF------LGEAFDGARD  34 SAA1
            VL  S++ F  F      + +  D  RD
Sbjct  551  VLTESNKKFLPFQQFGRDIADTTDAVRD  57 Spike
Query  39   YSDMREANYIGSDKYFHARGNY---DAAKRGPGGAWAAEVITDAR--ENIQRF  86 SAA1
            + ++RE  +   D YF+    +   +  +  P G  A E + D     NI RF
Sbjct  186  FKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRF  238 Spike
Query  30   DGARDMWRAYS------DMREANYIGSDKYFHARGNYDA  62
            D     WR YS        R    IG++   H   +Y+ 
Sbjct  627  DQLTPTWRVYSTGSNVFQTRAGCLIGAE---HVNNSYEC  662
Query  31   GARDMWRA  38
             ARD+  A
Sbjct  845  AARDLICA  852

   MKLLTGLVFCS-LVLG-VSS       Signal for expression of SAA1
   MF-----VF--LVLLPLVSSQCVNL  Signal for expression of Spike
here few fragments all by hand
      RS---------FFSF--LGEAFDGARDMWRAYSDMREA
      RSSVLHSTQDLFLPFF-SNVTWFHAIHVSGTNGTKRFDNPVLPFND  Spike
or another way:
               RS-FFS---FLGEA-------FDGARD---MWRAYSDMREA
TTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGT  Spike

PGDSSSGWTAGAAA--------YYVG------L--Q-PRT----------F----L-LKY SPIKE 
PGGA---WAAEVITDARENIQRFF-GHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY

and here comparison of SAA1 own fragments, similar to one another:

RSFFSFLGEAFDGARDM----WRAYSDM--REA   SAA1cont.1.
+ F    G  +D A+      W A      RE    IDENTITIES
KYFHAR-GN-YDAAKRGPGGAWAAEVITDARENIQ  SAA1cont.2.

KYF-HARGN--YD-AAKR--GPGG----AWA-AEVITDARENIQ  SAA1cont.1
++F H   +   D AA    G  G     +  A +     E     IDETITIES
RFFGHGAEDSLADQAANEW-GRSGKDPNHFRPAGL----PEKY   SAA1cont.3
              => usually cleaved upon amyloid formation
The above indicates SAA1 consists of domains with simiar properties..

And now by hand section of Spike having similar AA's composition to the amyloid

      RS---------F--FSFLGEAFDGARD---MWRA--YS--DMREA Amyloid SAA1
      RS         F  F F   + + +     +++A   S  +   + IDENTITIES
      RSSVLHSTQDLFLPF-F---S-NVT-----WFHAIHVSGTN--GT Spike 2020

and few other sections of Spike with similar character:

RSFFSF--LGEAF-DGARDMWRAYSDMREA ====SAA1
KRFDN-PVLP--FNDGV---YFA-STEK-S ====Spike 
or
RSFFSFLGEAF-DGA-----------RDMWRAYSDMREA ====SAA1
KRF-DNPVLPFNDGVYFASTEKSNIIRG-W-IF--GTTL ====Spike
and one more SPike fragment:
RSFFSFLGEAF-----DGAR--------DM-W-RAYSDM----R---EA ====SAA1
KDFGGFN---FSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDC

The above MODERNA sequence number 973 encodes 289 residues long human liver peptide. That’s HUMAN FGA (Fibrinogen alpha/beta chain family; pfam08702) protein from 2004 NIH MGC Project (NOT accessible at the claimed site any more http://mgc.nci.nih.gov !!!). Mammalian Genome Collection information can be found through the I.M.A.G.E. Consortium /LLNL at: http://image.llnl.gov, equally no more to find! NIH data base still has it at https://www.ncbi.nlm.nih.gov/protein/AAH70246.1 , whereby it is EXTREMELY important to read the COMMENTS lines in this link! Note the DIFFERENT name for the 49-191 part of the sequence, NIH calls it also ‘Fib2’.

>US_8999380_B2_973
MFSMRIVCLV LSVVGTAWTA DSGEGDFLAE GGGVRGPRVV ERHQSACK-DS
DWPFCSDEDW NYKCPSGCRM KGLIDEVNQD FTNRINKLKN SLFEYQKNNK
DSHSLTTNIM EILRGDFSSA NNRDNTYNRV SEDLRSRIEV LKRKVIEKVQ
HIQLLQKNVR AQLVDMKRLE VDIDIKIRSC RGSCSRALAR E-VDLKDYEDQ
QKQLEQVIAK DLLPVVNLQV TANNLLVARV TTEETPHLKA RAIKWQMRPE
VKPIMKEHIA PREAMLNLAL SEVSTLLLWG SLPCPPRLS       

BLAST-ing this 2004 MODeRNA sequence among non-patented proteins, gives:

- the 2005 sample from Tissue Procurement: CLONTECH from 2002 NIH MGC Project,

- the 2021 289 residues long proteins from a Puerto Rican, an FGA sample derived from his blood B-lymphocytes submitted to The Center for Computational Biology, Johns Hopkins University…? His FGA had ONE mutation V→L.

- next chimpansee sample had the same mutation but in addition, non homologous N→K, and 2 T→A mutations

- not the same but similar with the next orangutan sample.

The entire rest of fibrinogens are shorter or much larger samples. A 2005 much shorter version of NIH MGC human protein acquired by CLONTECH: https://www.ncbi.nlm.nih.gov/protein/AAI05804.1 ends exactly where the 2021 Puerto Rican sample got mutated, after the DLLP section :

Query  181  RGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPVVNLQ  219
            RGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLP  + Q
Sbjct  181  RGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQ  219

whereby completely different section appeared at the C-term: hlplhsslgdrarlhlktnktakkkkkkkkk, with 9 positive lysines at the very end!

Much longer 2015 FGA isoform https://www.ncbi.nlm.nih.gov/protein/ALQ33521.1 was from "pooled heart, liver, brain, testis and placenta tissues". That’s what Dana-Farber Cancer Institute was doing, alternative splicing of the same gene in different tissues. That’s where CDC director Walensky’s husband works, who carries the patent for part of the 2020 Spike… This longer FGA sample has after that DLLP section added following string of residues:

h lplikmkpvp dlvpgnfksq 241 lqkvppewka ltdmpqmrme lerpggneit rggstsygtg setesprnps sagswnsgss 301 gpgstgnrnp gssgtggtat wkpgssgpgs tgswnsgssg tgstgnqnpg sprpgstgtw 361 npgssergsa ghwtsessvs gstgqwhses gsfrpdspgs gnarpnnpdw gtlnlalsev 421 stlllwgslp cpprls

whereby the C-terminal portion of it was ‘almost;’ identical with the by MODeRNA in 2015 patented sequence AAH70246.1:

Query  261  PREAMLNLALSEVSTLLLWGSLPCPPRLS  289 MOD-eRNA 2015 patent
            P    LNLALSEVSTLLLWGSLPCPPRLS
Sbjct  408  PDWGTLNLALSEVSTLLLWGSLPCPPRLS  436 DANA-FArber 2015 (cancer?)sample

Now the Stunning: a 2023 chinese pedigree sample, fibrinogen alpha chain isoform alpha precursor, https://www.ncbi.nlm.nih.gov/protein/NP_068657.1, affected with Congenital dysfibrinogenemia due to variant of FGG gene, published in other work in J. Cardiothorac Vasc Anesth 37 (6), 942-947 (2023) in an article titled: “ Interaction Between Platelet and Fibrinogen on Clot Strength in Healthy Patients“, and many others, all related to the same sequence, which is ONE AMINO ACID different than KAI2536318.1, the 2021 to JHI submitted Puerto Ricarian blood sample, a T→A mutation :

Query  301  GPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTW  360
            GPGSTGNRNPGSSGTGGTATWKPGSSGPGS GSWNSGSSGTGSTGNQNPGSPRPGSTGTW
Sbjct  301  GPGSTGNRNPGSSGTGGTATWKPGSSGPGSAGSWNSGSSGTGSTGNQNPGSPRPGSTGTW  360

All what is needed now is to look at the literature history of that ‘pathological’ NP_068657.1 entry:

a) Blomback,B., Hessel,B. and Hogg,D. “Disulfide bridges in nh2 -terminal part of human fibrinogen.” Thromb Res 8 (5), 639-658 (1976)

b) Fretto,L.J., Ferguson,E.W., Steinman,H.M. and McKee,P.A. “Localization of the alpha-chain cross-link acceptor sites of human fibrin.” J Biol Chem 253 (7), 2184-2195 (1978)

c) Cottrell,B.A., Strong,D.D., Watt,K.W. and Doolittle,R.F. “Amino acid sequence studies on the alpha chain of human fibrinogen. Exact location of cross-linking acceptor sites.” Biochemistry 18 (24), 5405-5410 (1979)

d) Watt,K.W., Cottrell,B.A., Strong,D.D. and Doolittle,R.F. “Amino acid sequence studies on the alpha chain of human fibrinogen. Overlapping sequences providing the complete sequence” Biochemistry 18 (24), 5410-5416 (1979)

e) Fish RJ and Neerman-Arbez M. “Fibrinogen gene regulation” Thromb Haemost 108 (3), 419-426 (2012)

f) Hoppe B. “Fibrinogen and factor XIII at the intersection of coagulation, fibrinolysis and inflammation.” Thromb Haemost 112 (4), 649-658 (2014)

which indicates a timely flow on information needed to develop what we are dealing with now.

That 2015 (filed in 2013) ModeRNA patent seems to be connected with all sorts of Hereditary Hypodysfibrinogenemia, Hereditary Hypodysfibrinogenemia, Congenital dysfibrinogenem in China, Thromboembolic Pulmonary Hypertension in Turkey.

One more pre 9/11 entry, a 2001 entry coded AAK31372.1 (LOCUS AF361104_1), equally encoding the fibrinogen alpha chain preproprotein, isoform alpha. The difference between the this 2001 and the in 2023 deceased samples NP_068657.1, the C-terminal is different, ‘LPCPP’ in 2001 →’PSLSP’ in 2023:

Query  601  YKMADEAGSEADHEGTHSTKRGHAKSRPVRGIHTSPLGKPSLSP  644  2023 NP_068657.1
            YKMADEAGSEADHEGTHSTKRGHAKSRPVRGIHTSPLGK    P
Sbjct  601  YKMADEAGSEADHEGTHSTKRGHAKSRPVRGIHTSPLGKLPCPP  644  2001 AAK31372.1

And now go to MEROPS data base (https://www.ebi.ac.uk/merops/cgi-bin/specsearch.pl) and try to find which enzyme digests the -PP- bond, rarely anything…

Thus the pre-2001 fibrinogens were VERY STABLE, but no more now, in 2023!

Also remember, the synthetic Spike in the covid genetically modifying injections contains on purpose the -KV-→ -PP- undigestible modification….

---

Amyloid plaques possibly accumulate due to mercury inhibition of digestive enzymes which would take apart those amyloids. Low levels of mercury also HYPER phoshorylate the tau proteins, connecting tubulin with neurofibers. All enzymes related to brain build ups are always MERCURY inhibited.

This chaotic post will end with this important summary from https://link.springer.com/article/10.1007/BF01683593 , a paper titled “In vitro inhibition of digestive enzymes by heavy metals and their reversal by chelating agent: Part I. Mercuric chloride intoxication“:

“The effect of mercury on alkaline phosphatase, lipase, aminotripeptidase and glycylglycine dipeptidase in the liver and digestive tract of Channa pynctatus is investigated in vitro. Mercury inhibits the activities of all these enzymes and the degree of inhibition increased with the increase in the concentration of the metal. Addition of EDTA, a chelating agent, restored the mercury inhibited enzyme activity and the degree of restoration was related to the concentration of the chelating agent.”

Seems like chelation first and then digestion, could be one way out here. This post had some of it while using EDTA:

In the https://go2.thetruthaboutcancer.com/eastern-medicine/episode-3/ at ~17:00 there is a practitioner who is using the following detox suppositories products (according to the patent https://patents.google.com/patent/US6720356B2/en :

• Medicardium (Magnesium EDTA chelation for heavy metals and calcifications while removing lead, mercury, aluminum, cadmium, arsenic, uranium, nickel, barium, thallium, oxidized irom (Fe +3)

• Xeneplex, i.e. Glutathione/organic cofee removing pesticides, petrochemicals, pharmaceuticls, molds, solvents, artificial colors,

• Glytamins, herbs and amino acids for liver/gallstones/kidney stones/, bile sludge, parasites, candida, constipation

That biological dentistry can help anyone, including MD’s, with finding connections between the health status of ones mouth and any other organ in the human body, illustrated in a diagram at the very end of this post.

An update from 4/8/2024 needs one important addition. The ‘non-digestible’ Spike fragment which suppose to be responsible for the ‘super-binding’ mode to other proteins and possibly building the cloths: ‘KSTNLVKNKCVNFNFNGLTGTGVLTESNKK‘ has a very high homology with a 2001 PATENT EP 1074617-A2 for HUMAN ‘Primers for synthesising full-length cDNA and their use’…

Thank you all readers (if any, given google searches for this substack…) for attention and your TIME!

Literature.

1. T.J.C. Tan et al. “High-throughput identification of prefusion-stabilizing mutations in SARS-CoV-2 spike“ Nature Communications Vol. 14, Article number: Apr 2003 (2023) https://www.nature.com/articles/s41467-023-37786-1

2. 2017 Editor(s): Richard J. Miron & Joseph Choukroun “Platelet Rich Fibrin in Regenerative Dentistry: Biological Background and Clinical Indications: Biological Background and Clinical Indications“.