Update 7/16/2023: Fauci is fraud and his actions full of CRIME even officially:
https://forbiddenknowledgetv.net/todd-callender-our-entire-government-are-actors/
Update on 14th Of Jan 2023: One of the TOP killers in this world is Bill Gates:
https://stopworldcontrol.com/gates/
closely working with FDA/NIH/NIAID=>Fauci on development and implementation of covid19 gene therapies:
A good summary of Gate’s life and connection all the way to WWII, in german though is at: https://www.bitchute.com/video/8H7feBeKOdcN/ , according to which, Dr. Fauci is the leadership council for BMGF..
Is it an accident that the very same universal SARS-CoV-2 Spike genetic code shares so many common PATENTED pieces of GMO plants developed by Monsanto et al.. ? That’s the so called food Americans are fed for the last ~25 years, hybrids between plants and pieces out of pathogenic soil bacteria and plants viruses…. All thanks to Rockefellers/Carnegies+Gates, with an FDA approval, assuring all is ‘safe’. At least no effectiveness assurance happened with the GMO food, except for the sickest nation in this world. How strange, that Mr. Steve Kirsch can’t see or say NOTHING WRONG about Gates??
In the patents section of this post there is new information about Mod-E-RNA new gene therapy in form of modmRNA injections targeting CARDIOvascular issues! That after 3 years of generating the problems with Covid gene therapies. Sounds like generating a problem for which now there is a solution.
Update on May 18th 2022 regarding Haemophilus Influenza and Spike bioinformatics is at the end of this post. Also importance of Spike epitopes.
This addition should have been done long time ago, a remark about the June 2017 preparation of the US government for the coming covid19 pandemic. That’s the document from FDA pages (https://www.fda.gov/about-fda/non-profit-and-other-mous/mou-225-17-019) with the title: MOU 225-17-019 “MEMORANDUM OF UNDERSTANDING BETWEEN THE FOOD AND DRUG ADMINISTRATION
AND THE BILL & MELINDA GATES FOUNDATION”.
This ‘collaboration’ between FDA and Bill and Melinda Gates Foundation had a specific goal, quote:
“This memorandum of understanding (MOU) establishes a framework for collaboration between FDA and the BMGF to facilitate existing and new mutually agreed upon programs and activities and to carry out their common goal to improve public health by stimulating and fostering medical product innovation and enabling medical product development.“
The “Substance of the agreement section. (IV)” indicates 3 arena’s for the above:
-Regulatory Science
-Expansion of regulatory capacity building.
-Global public health.
Everything from here, via ‘fear of security’ connects to cooperation between FDA, HHS, ASPR, PHEMCE, CDC, NIH, DHS and finally DoD, for a long time. And although 9/11 was a clear ‘mechanical’ issue with incredible human tragedy, officially linked to terrorism, only few probably know that it actually started with ANTHRAX threat. That led to the so called project BioSHIELD, signed into law in 2004:
And the threats continued, with new simulations first and reality following soon after: https://shiftfrequency.com/who-gates-foundation-big-pharma-execs-took-part-in-a-2021-monkeypox-pandemic-simulation/
with the science community supporting immensely the goal of the money/political/medical mafia, while being actually the most decisive part of it, “Persuasive messaging to increase COVID-19 vaccine uptake intentions“ ( https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8531257/ ). The top science officials like A. Fauci, were rewarded by this new opportunity to ‘immunize’ everyone, quote from 9/28/2022 CHD article:”Top paid: Fauci continued to be the most highly compensated federal employee earning $456,000 in 2021 and $480,000 in 2022. Fauci out-earned the president, four-star generals and roughly 4.3 million other federal bureaucrats.” The fact that this man, managed to administer >600mln of covid injection materials in American arms, should never be forgotten. And the final solution, was clearly connected to the very begin, the origin of SARS-Cov-2.
The discovery described in an amazing post:
was possibly the reason for the ‘Ukraine issue’, a known maneuver to redirect the public’s attention when an uncomfortable new discovery shows up. This is a short post to add to the BLAST issues described and explained so well by Dr. Syed, and this one is about the C-terminal portion of the Spike protein, genome of which is being injected into billions of arms. The C-terminal portion of Spike is remarkable, because it is conserved among many old style coronaviruses. But also for example piece of BLAST alignment for the Spike 2020 (Query line) and the ‘Avian influenza chimeric VLPS’ from the Patent US 8551756-B2 10 08-OCT-2013 by Novavax, Inc.; Rockville, MD, with its sequence in the Sbjct line and the line inbetween representing the identities (the first part being 100% identical):
Query 1137 VYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNES VYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNES
Sbjct 1119 VYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNES 1178
Query 1197 LIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSC
LIDLQELGKYEQYIKWP L + + + + + IM+ + S C G C C
Sbjct 1179 LIDLQELGKYEQYIKWPQI--LSIYSTVASSLALAIMMAGL-SLWMCSNGSLQCRIC 1232
shows significant overlap, and so it the overlap of the 2005 Bat SARS coronavirus HKU3 (Q3LZX1.1) and the 2020 Spike (YP_009724390.1) even better, 76% identities over the entire length of 1273 residues, but for the C-terminal section below, almost 100% overlap:
Query 1201 QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDD QELGKYEQYIKWPWY+WLGFIAGLIAIVMVTI+LCCMTSCCSCLKG CSCGSCCKFDEDD
Sbjct 1170 QELGKYEQYIKWPWYVWLGFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDD 1229
Query 1261 SEPVLKGVKLHYT 1273
SEPVLKGVKLHYT
Sbjct 1230 SEPVLKGVKLHYT 1242
What if we search for sequence:
“KYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT”
matching that C-section of the Spike 2020, not among bats but among different species, for example snakes (taxid:8570)? The best hit comes for synaptotagmin-17 [XP_026580472.1, Pseudonaja textilis], (a family member of membrane-trafficking proteins that are characterized by an N-terminal transmembrane region) with 43% sequence coverage and 35% identities. Default BLAST parameters won’t show anything, but changing the ‘expect threshold’ value to much larger numbers results in huge amount of smaller sections, with just this one special example:
30.4 bits(67) 2e-04 Compositional matrix adjust. 14/40(35%) 25/40(62%) 3/40(7%)
Query 1223 GLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSE 1262 spike
GL++ ++ +L C +C +C + C C SCC+ +ED+ E
Sbjct 8 GLLS--RISDLLLCRWTCRNCCQKCYEC-SCCQSNEDEVE 44 N-term of the synaptotagmin (the TRANSMEMBRANE reagion)
The 2020 spike C-term covers the N-terminal portion of that protein responsible for exocytosis not only in snakes, but also in humans. A 2021 study^1 points to more functions of that protein, clearly indicated in its title: ”Synaptotagmin 17 controls neurite outgrowth and synaptic physiology via distinct cellular pathways”.
Here the direct full comparison, in one more of the possible alignments:
GLLS--RISDLLLCRWT-CRNCCQK-CYEC-SCCQSNEDEV-EILGPF synaptotagmin
GLIAIVMVT-IMLCCMTSCCSCL-KGCCSCGSCCKF-DEDDSEPVLKG Spike2020
The ‘DEDDSE’ section of Spike was always special (high homology to the commercial anti-VMAT-2 antibody) due to its highly -5 negatively charged character, right between the rich Cysteine section and the positively charged rest of the Spike C-terminus. Now looking for similar but PATENTED biological objects, one gets the first hit for the 2013 patent US 8586006-B2 from Institute for Systems Biology and Integrated Diagnostics, Inc.; Seattle, WA (filing in 2007) for “Organ-specific proteins and methods of their use“ which compares with the spike almost like the snake protein:
Query 1230 VTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSE 1262 SPIKE
++ +L C +C C + C SCC+ ED+ E
Sbjct 17 ISGLLLCRWTCRHCCQKCYE-SSCCQSSEDEVE 48 PATENT
The owner of that patent is Dr. Leroy Hood, he is a very good friend of Dr. Fauci and Bill Gates, who donated 12 mln in order to start up Hood’s ISB institute(wiki source):
https://bioquicknews.com/tony-fauci-interviewed-by-science-legend-leroy-hood-presented-luminary-award-of-precision-medicine-world-conference-pmwc-2021-at-opening-day-of-pmwc-2021-virtual-meeting-january-25-27/
“Tony Fauci Interviewed by Science Legend Leroy Hood & Presented Luminary Award of Precision Medicine World Conference (PMWC 2021) at Opening Day of PMWC 2021 Virtual Meeting (January 25-27)–“21st Century Precision Medicine in the Age of COVID-19”
https://isbscience.org/news/2021/01/26/drs-anthony-fauci-lee-hood-talk-covid-19-vaccines-future-of-research-more/
The 2013 Hood’s patent is cited by 3 MODERNA patents and by 2014 DNA2.0 patent for “DNA vectors, transposons and transposases for eukaryotic genome modification”. DNA2.0 is a silicon valley company which participated in design of the Mod-eRNA vector used in all their covid19 gene therapy injections listed in their 2020 patent for “BETACORONAVIRUS MRNA VACCINE“ US 10,702,600 B1.
On the 9th of Jan 2023 Mod-E-RNA announced its modmRNA pipeline plans:
which includes mRNA-0184 encoding for relaxin, a naturally occurring hormone that is known to cause hemodynamic changes that are potentially beneficial for heart failure patients. The mRNA sequence of mRNA-0184 is engineered to instruct the body to produce relaxin with an extended half-life. That new ‘vaccine’ is based on the Aug 2020 patent described at https://www.ncbi.nlm.nih.gov/protein/QPW22159.1 with a fragment from the relaxin protein, having a very striking similarity with the 2 mentioned below Spike’s epitopes:
FSRAVADSWMEEVIKLCGRELV (Human Relaxin in new ModERNA patent)
YHKNNKSWMESE S1-25 (SARS-CoV-2 Spike’s epitope)
FSRAVADSWMEEVIKLCGRELV (Human Relaxin in new ModERNA patent)
SWMESEFRVYSS S1-26 (SARS-CoV-2 Spike’s epitope)
It appears that Hood L. patented already in 2011 identical fragment of the human relaxin (QPW22255.1) whereby his application at that time was described in the title as “Methods for identifying and monitoring drug side effects“ (US 7883858-B2 623 08-FEB-2011). Janssen Pharmaceutica N.V. patented similar fragment in US 7893197-B2 81 22-FEB-2011 and so did Novartis AG in US 10588980-B2 24 17-MAR-2020, whereby the latter makes use of the similar sequence in ‘Fatty acids and their use in conjugation to biomolecules‘. Looks like the human relaxin protein was an object of interest for a long time, in particular because it was not related to heart alone. According to 1990 publication (https://pubmed.ncbi.nlm.nih.gov/2194740/ ): Relaxin is a hormone of reproduction that appears to affect parturition, uterine accommodation, and sperm motility to varying degrees in many species. Uniprot entry on the relaxin prohormone describes it little bit more:”Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.” So the question would be now, is mod-E-RNA targeting the heart AND birth canals in 2023, after what they’ve done with their gene therapies since their introduction in 2021?
(New Section in progress…)
To all covid injected, PLEASE BE VERY MUCH AWARE of the by ‘Global COVID-19 Summit’, announced federally funded inventions with the COVID-19 Technology Access Pool, organized by the World Health Organization (WHO). WHO then turns over the licenses to a nonprofit, the Medicines Patent Pool (MPP):
https://www.science.org/content/article/pretty-big-deal-u-s-makes-covid-19-technologies-available-use-developing-countries
Given that in the minds of the globalists, the pandemic is not over:
the by Todd Callender vision of ‘patented humans’, is not that far off any more. Todd has extremely informative page at: https://www.truthforhealth.org/2022/04/todd-callender-the-role-of-hospitals-covid-injections-and-5g-in-genocide/
A quote from that above mentioned science article today:
“Created in 2010, MPP today has patent agreements for several anti-HIV drugs and recently added two treatments for COVID-19, Pfizer’s Paxlovid and Merck & Co.’s molnupiravir. The new agreement also covers inventions used by companies that make existing COVID-19 vaccines, such as a modification that stabilizes spike, the surface protein of SARS-CoV-2. Companies could also use the technologies to make entirely new products. Research tools for drugmakers and diagnostic assays are also part of the agreement.“
Please be aware that both the drugs mentioned above, Paxlovid and Molnupiravir, like Remdesivir:
are nucleoside analogs, with the exception for the addition of the HIV protease in Pax-lovid~Pax-Love-it = Peace-love-it… What an irony to put covid and HIV 'meds' together and now make a loving peace in its name!!! In my opinion, it’s a slap, or better, a spit in human face. We know Spike has many HIV ‘insertions’ allowing for a constant new infections, so whatever doesn't bind to the RdRp enzyme, the RNA-dependent RNA polymerase, which btw. never existed in human cells until HIV came ( together with Fauci), won’t be approved by ‘FDA’ as remedies against ‘covid’. The lethal mutagenesis mechanism which comes with the Merck’s Molnupiravir can’t be switched off so easy. All nucleotide analogs will interfere with GENETIC information driving our human bodies, contributing the no 1 ‘side effect’, cancer, but also contribute to the next step in human history:
The ‘Spike’ protein and its genome, and everyone who tries to force it upon humanity, is our ENEMY no 1, in terms of all ‘covid related issues’.

18th May 2022.
A comparison of the SARS-CoV-2 Spike protein (YP_009724390.1) with the H5H1 flu RdRp (NIH code AAO53056.2) using BLAST with very customized search parameters, delivers astonishing ~70% of identities across the ~70% sequence coverage. Some of those homolog sections of these 2 sequences are for example:
21.0 bits(42) 0.41 5/7(71%) 6/7(85%) 0/7(0%) (for the first line)
Query 405 SWIQSEF 411 H5H1 RdRp AAO53056.2
SW +SEF <<<< IDENTITIES
Sbjct 151 SWMESEF 157 SARS-CoV2 Spike
Query 219 LPPNFSSLE 227 H5H1 RdRp AAO53056.2
LP FS LE <<<< IDENTITIES
Sbjct 216 LPQGFSALE 224 SARS-CoV2 Spike
Query 116 RFIEIGVT 123
RF IGVT
Sbjct 905 RFNGIGVT 912
Query 645 VFN-----SLYA 651
VFN S YA
Sbjct 341 VFNATRFASVYA 352
Query 270 LPDGP--PCSQRSKFLLMDALKLSIED 294
LPD P P S RS F IED
Sbjct 806 LPD-PSKP-SKRS-F---------IED 820
Query 669 AQALRDNLEPGPSILEGYMKQLRS 692
AQAL + L KQL S
Sbjct 956 AQAL-NTL----------VKQLSS 968
Query 586 LQSLQ-----QIESMI-EAE 599
LQSLQ Q +I AE
Sbjct 1001 LQSLQTYVTQQ---LIRAAE 1017
Query 659 SAESRKLLL 667
S E LLL
Sbjct 746 STECSNLLL 754
Query 504 IIKGRSHLRNDTDVVN-FVS 522
II TD N FVS
Sbjct 1114 IIT--------TD--NTFVS 1123
Query 247 SQMSKEVNARIEPFL 261 chicken RdRp
SQ PFL
Sbjct 172 SQ----------PFL 176 SARS-CoV2 Spike
Query 348 IENEEKIPKTKN 359
+E+E ++ + N
Sbjct 153 MESEFRVYSSAN 164
and many more sections, with query being the Influenza A chicken virus RNA-dependent RNA polymerase subunit PA and Sbjct line representing the sequence of the covid19 Spike protein, encoded by the synthetic mRNA injected into billions of arms! That high level of similarity is the reason for among others, this Stanford University publication^2: ”Development of CRISPR as an Antiviral Strategy to
Combat SARS-CoV-2 and Influenza” or the one by chinese researchers^3: “Rapid design and development of CRISPR-Cas13a targeting SARS-CoV-2 spike protein“ and many more cited in these two applying the gene editing techniques in regard to ‘combat the SARS-CoV-2 pandemic’. The PD 2015 NIH patent for: “LENTIVIRAL PROTEIN DELIVERY SYSTEM FOR RNA-GUIDED GENOME EDITING“ was a good preparation for this, to edit the species, depending on what those, who pay the scientists, have in their plans. And just a reminder, examples of lentiviruses, a suclass of retroviruses, include for example HIV-1, HIV-2, SIV, BIV, FIV with S→simian, B→bovine, F→feline. HIV and genome editing?? Dr. Fauci will definitely know more about it.
It all really could be a coincidence, if it was not for the publication titled:
“Linear epitopes of SARS-CoV-2 spike protein elicit neutralizing antibodies in COVID-19 patients“ published by Yang Li et al. in 2020, in which the table 1. lists two peptides:
YHKNNKSWMESE S1-25
SWMESEFRVYSS S1-26
whereby the first and the last from the above BLAST search result, have remarkable homology with the S1-26 peptide, specifically synthesized for searches of the neutralizing antibodies against covid19. Why would chicken INFLUENZA RNA polymerase contain highly homologous pieces of exactly these sections of Spike sequence which can ‘elicit the neutralizing antibodies’ against covid19??? There are countless examples like that when searching around. It is as if the influenza virus was already some kind of precursor of corona. No wonder, those who had the flu and were exposed to the old corona viruses never get the ‘covid 19’. Well, unless they are exposed to 5G, nanoparticles from the geoengineering, and also to those, who already received covid gene therapies and are shedding their undisclosed ingredients list..
Gates started with computer=>information=>programming business and probably will end with it, replacing the programming section with HUMANS:
Literature:
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6684635/
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7189862/pdf/main.pdf
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7738867/pdf/thnov11p0649.pdf
Not sure which of your posts to put this in, but it is amusing in relation to HIV-1 Tat arginine-rich motif so I thought you'd appreciate it. Namely, H5N1 uses the same Tat-derived motif that Covid Spike does. This post is talking about funny business in 2009 Ukr involving the same band of characters who are destroying the world today.
https://scamerica.substack.com/p/stop-plandemic-bird-flu
why aren’t they all in jail yet?