The last messages from the covid19 crimes exposing doctors, Dr. Rashid Buttar and Prof. Arne Burkhardt. Spike related issues, continue... The PACSIN's.
Update 12/27/2023: the last interview with Prof. Arne Burkhardt in his own lab at https://uncutnews.ch/letztes-interview-mit-dem-verstorbenen-pathologen-arne-burkhardt-ueber-die-grosse-gefahr-von-mrna-impfstoffen/
Update 11/18/2023: An mRNA book by scholars written To the memory of Prof. Arne Burkhardt, MD can be found and should be spread A.S.A.P. at: https://doctors4covidethics.org/mrna-vaccine-toxicity/
Update 8/14/2023: The groundbreaking work (in pathology of the coivid injected victims) by the deceased Prof. Burkhardt will be continued! A new german report at:
Update 7/28/2023: Extremely important updates from Tod Callender in interview with Dr. Jane Ruby: https://www.brighteon.com/23fe00ff-21cf-44b1-a380-82b0d122eee6
Update 7/23/2023: EXPOSE publishes today an important article at: https://expose-news.com/2023/07/23/deagel-cia-dod-rockefeller-depopulation/
While the shock after the sudden death of Dr. Rashid Buttar (USA) on the 18th of May ‘23 is still there
, the next one hit soon after, on the 30st of May 2023, Prof. Arne Burkhardt (Germany), pathologist investigating deaths after the covid injections, was announced dead. Across the world there were not too many scientists, who stood against the disinformation and crimes related to covid19. The both mentioned heroes were true scientists, extremely busy, Rashid with living and Arne with the dead covid injected patients. Already 3 months after the introduction of the covid injections campaign in Germany, Prof. Burkhardt was overwhelmed with requests from families who lost their relatives and didn’t believe the official narrative of that apparently natural death. How many will continue the importance of their work, given that the consequences of covid ‘countermeasures’ covering up for the universal global gene modification treatment via injections of synthetic genetic constructs mixed with exotic materials of unknown technological capabilities, are not being looked into on a wide scale by the same medical sector, which is supporting this tragedy.
Dr. Rashid Buttar’s last message needs to be kept in mind:
https://expose-news.com/2023/06/02/rashid-buttar-there-is-something-of-a-critical-nature/
with Dr. Heiko Schoening underscoring the importance of Dr. Buttar’s work at:
https://www.brighteon.com/04d00463-ec2f-4828-841a-4a959647c805
where he talks about a joint documentary with him, “The Big Reset“
Prof’. Burkhardt’s testimony in front of the EU parliament (the ONLY German representing this country..), on the 3rd of May 2023, just before his death on the 30st of May, is equally extremely important:
https://expose-news.com/2023/06/03/tributes-pour-infor-professor-arne-burkhardt/
After that event Prof. Burkard gave another speech in German, here the link:
showing, he was in a perfect condition… That article shows huge amount of important links relating covid injections with deaths. All the above is essential for grasping the inconvenient truth of covid gene modifications directly related to so many deaths and injuries by now... A summary of tributes for both HEROES is listed in a new addition to my old post titled “Nov the 1st: The lists of dead scientists.“ Another hero on the truth seeking arena is Prof. Sucharit Bhakdi (still alive for our luck!!), who gave an excellent talk in which he explains the results from the molekularbiologist Kevin McKernan presented to him at: https://rumble.com/v2owij0-why-the-covid-mrna-vaccines-are-actually-dna-gene-therapies-that-must-be-re.html . His new interpretation of it for a 12-years old, i.e. all politicians, can be found at: https://report24.news/der-wichtigste-vortrag-meines-lebens-prof-bhakdi-klaert-ueber-gefaehrliche-fremd-dna-in-impfung-auf/. I’d just add, once a cell is DEAD, it won’t heal, get repaired, become a living part again, at least in this world without wonders..
The covid injections investigated by the two deceased researchers, carry SARS-CoV-2 Spike amino acid sequence with slight modifications or in the form of a synthetic extremely toxic protein or in the form of synthetic genetic sequence, x-times more toxic for many reasons, staying nobody knows for how long in human bodies. Despite of these known terrifying facts, EARLY in the injection campaign ^1, ^2, ^3, ^4, the production of exactly that Spike, whether in form of its synthetic genes (falsely called ‘vaccines’) or in the bodies expressing them (the covid injected) exploaded worldwide. The citation ^4 from Apr 2021:“Salk researchers and collaborators show how the protein (the Spike) damages cells, confirming COVID-19 as a primarily vascular disease.” if taken seriously, should have stopped everything right there. And even the later on fast growing VAERS deaths reports didn’t do it, Pfizer, Mod-E-RNA in Aug 2020 published studies, showing clearly deaths and injuries did equally nothing, and even the in 2022 uncovered by Pfizer hidden (for the planned 75 years discovery…) ~1200 deaths among ~44,000 participants, didn’t change ANYTHING!!! That ~2.7% probability of death by injection in comparison to ~0.01% death by covid (age group dependent), an extreme of ~270 times greater probability of death AFTER the jab then on ANYTHING covid related…, that too, fell on deaf ears. That all thanks to media, smart programmable devices and human ‘covid-induced isolation’. On one side reports like this one:
https://www.cnn.com/2020/05/06/us/university-of-pittsburgh-professor-killed/index.html
put doubts on serious issues, and on the other, a serious science source phys.org publishes the following:
https://phys.org/news/2021-10-death-threats-trolling-common-scientists.html
the example of the ‘common theme’ of fitting into the narrative, quote: “"For those of us who have been pulling apart anti-vaccine misinformation from pre-pandemic times, the presence of these attempts at intimidation is very wearying, but not surprising," Head said.“
Further from the apparently harassed ‘covid measures’ supporters:
“Of those who did report the harassment, nearly 80% said that they received support from their employer” => which reads, almost all employers were/are in the ‘covid business’, money-wise.
Everybody knows all this, so going back to the spike little bit more, looking at who publishes what, in the ‘serious science’, being the origin of this all.
The details of the ‘synthetic Spike’ crime can be as small as an example of 3 tiny degradation products of Spikes^2 (in one letter code of amino acids): QCVNLTTRT, RVYSSANNC and NNAYN which can bind to Acetylcholineesterase (AChE), superoxide dismutase (SOD) or catalyse…. What can go wrong when putting these TINY peptides in P. cuvieri tadpoles? One scenario, if it binds AChE, that AChE won’t be accessible for normal functions. AChE inhibition is known to impair oxidative phosphorylation, cause neuronal Ca2+ influx and activation of nNOS, ending with neurons’ oxidative and nitrosative injury. The final message in ^2, ‘these tiny peptides cause REDOX imbalance and cholinesterasic effect’.
The same team, 0.5 year later, which now grew to 65 people(!!!), in studies on zebrafish^5, eukaryots like we, having ACE2 with 58 and 72% primary sequence identity and similarity to human ACE2, showed, that Spike fragment 16 to 165 (rSpike) showed adverse effects on liver, kidney, nervous and reproduction system. That fragment contained all the 3 tiny peptides from their ^2 study, except they cut the last cysteine in RVYSSANN-C.. Their final message, quote : “fish injected with rSpike produced a toxic inflammatory response with similarity to severe cases of COVID-19 in humans“ and “Histological alterations were analyzed in the liver as mild lobular infiltration by small lymphocytes, centrilobular sinusoidal dilation, patchy necrosis, moderate microvesicular steatosis, mild inflammatory infiltrates in the hepatic lobule, and the portal tract. These changes are similar to those observed in patients with COVID-19 (Tian et al., 2020).“
No fever, caughing, sneezing, etc., was reported, for the fish…..
The team closes with quote: ”Therefore, besides representing an important tool to assess the harmful effects of SARS-CoV-2 in the aquatic environment, we present the zebrafish as an animal model for translational COVID-19 research.”
Their samples in all images were treated with nuclei and ECM stain in contrast to research of Prof. Burkhardt, who always used spike-antibody AND nucleoprotein staining, in order to show that it is the covid injected Spike which accumulates in the affected organs.
The major issues with this study are:
-the 65 authors DO NOT say a single word about the fact, that this very same in the fish injected Spike causing so much trouble is also produced in the covid injected, causing death and injuries, partly because it is produced in much higher amount than during the infection, and in much more affected organs than in the natural infection (!!). A clear statement “The application of spike protein in zebrafish was highly toxic that is suitable for future studies to gather valuable information about ecotoxicological impacts, as well as vaccine responses and therapeutic approaches in human medicine.“ simply omits the fact, that in 2022 there are countless victims already dead AFTER the injections, but the talk here is only about the ‘covid19 sick people’ and future studies of ‘vaccine responses’!! That’s pre-reviewed ‘approved’ science.
-how the fish got ‘infected’??? Answer, quote:”We performed 2 intraperitoneal (IP) inoculations of a solution containing 1 μg purified rSpike diluted in 10 μL of inoculation buffer (7 M urea, 50 mM Tris-HCl pH 7.5, 200 mM NaCl, and 1 mM EDTA). A group of control animals received injections containing only the dilution buffer.” !!!!
Infection through injection??? That sounds like what Dr. J. Mikovits is saying all the time… Plus since when the virus, or ANY protein for that matter, stays properly folded at ~7M urea??? At that concentration the fold of that INJECTED Spike piece (equivalent to ‘vaccine’) is gone. Why didn’t they take the expressed Spike and dissolve it in water with the swimming (to be victimized..) fish, to show actually that water contact can cause infection?
-ACE2 binds to the sc. Receptor Binding Domain (RBD) of the Spike, officially at https://www.ncbi.nlm.nih.gov/protein/1796318598 in the NIH data base defined as:
301 ctlksftvek giyqtsnf ==> ACE2 receptor binding domain starts here:
rv qptesivrfp nitnlcpfge vfnatrfasv yawnrkrisn
361 cvadysvlyn sasfstfkcy gvsptklndl cftnvyadsf virgdevrqi apgqtgkiad
421 ynyklpddft gcviawnsnn ldskvggnyn ylyrlfrksn lkpferdist eiyqagstpc
481 ngvegfncyf plqsygfqpt ngvgyqpyrv vvlsfellha patvcgpkks tnlvknkcvn
541 f
thus this fragment the 65 authors say is toxic, is not even the piece binding the presumable ACE2 target….
-Acknowledgement, quote: We would also like to thank the entire organizing team of the Global Virtual Hackathon 2020 for the award our team received and the support from the Ministry of Transport, Communications and High Technologies of the Republic of Azerbaijan, the United Nations Development Program, and the SUP.VC Acceleration Center.
There are many, if not majority of all the SARS-CoV2 studies like this example, which show the frightening tendency of grabbing more and more scientists to perform certain tasks for certain purposes, while eliminating lot of logic in their work and always, completely falsely, putting the name of genetic material equivalent to content of ‘vaccines’. Lot of these studies investigate the toxicity of the SARS-CoV-2 Spike, yet do not mention, that exactly that Spike is being intentionally produced by the covid mod mRNA injected, who have to deal with that toxicity, after their own pre-injection HUMAN genome expression has to be modified in order to become a ‘manufacturing factory’ of a foreign synthetic invader.. Few more examples of that word deception, which includes ‘therapeutics’ at best, instead of modification, all lacking the basics of biology ever since 2020 (equivalent to a replacement of the word mother with ‘birthing person’!) with quotes from the published abstracts:
“mRNA vaccines have emerged rapidly in recent years as a prophylactic and therapeutic agent against various diseases including cancer and infectious diseases.“ (chinese trial of incorporation of NEW amino acids mixed with the synthetic mod mRNA genes) ^6
“Here, the aim of the present study is to characterize the pathogenic effects of SARS-CoV2-derived S1 (subunit 1 of the spike protein) on the lung vasculature in mice transgenic for human ACE2. In this model, we also explore the ability of S1 to activate the complement system, which may contribute to lung damage.“(italian study) ^7
“Knowledge gained from mRNA technology used to combat COVID-19 is assisting in the creation of treatments and vaccines to treat existing illnesses and may avert pandemics in the future.”(indian-american collaboration)^8
One older publication does use the proper wording:
“5. Other gene therapy applications AMC (not available yet#)HIV infection and AIDS Inhibition of HIV replication by HIV‐1‐specific short hairpin RNAs delivered via a lentiviral vector.” (Netherlands)^9
Since HIV gag and tat proteins connection to SARS-CoV-2 Spike is very interesting, and the RNA/DNA bioinformatics details are extremely important in covid injections, in the same journal with the ^9 publication, one can find for example “RNA sequencing and bioinformatics analysis revealed PACSIN3 as a potential novel biomarker for platinum resistance in epithelial ovarian cancer“ ^10. The importance of that protein family “PACSIN proteins in vivo: Roles in development and physiology“ ^11 in HIV viral spreading is connected with a “PPXY” motif-dependent retroviral budding^12. Even the HIV spread assuring Gag and Tat proteins, have only homologs of that motif, but SARS-CoV-2 Spike has it, 100%, right at the begin of the S1 domain. The residues ‘PPAY‘ represent positions 25-28 of the Spike in NIH data bank at: https://www.ncbi.nlm.nih.gov/protein/1796318598
The fact that the covid Spike ‘vaccines’ have a change in the amino acid sequence ‘lsrldKVeae’ to ‘lsrldPPeae’, implicates even harder digestion of that synthetics, given that not too many human proteases can cut inbetween the prolines P-P, and actually none between the PP-AY (check at https://www.ebi.ac.uk/merops/cgi-bin/specsearch.pl ) This Lys-Val to Pro-Pro switch in all covid injections would be an easy test to prove that the wild type of the NIH stored version of Spike indeed exists in the covid19 infected, BUT not injected. Yet, the main specialist on this topic here on sub-stack, Anandamide (MIT…) is not responding with a single comment on it. So pity…..
The PACSIN’s are comprising three protein members, PACSIN1 (Q9BY11), PACSIN2 (Q9UNF0) and PACSIN3 (Q9UKS6), all 3 with ~50% identical amino acid sequence. All religious people, please forgive this remark, ‘science’ seems to like the Holy Trinity and associate SINS with it… The Haemophilus Influeanzae protein ABQ99175.1 with countless
SINQ motifs, was mentioned in my post titled “SARS-CoV-2 Spike, engineered clots in human blood vessels, infertility, psychedelics, and the way to develop cancer after the covid genetically modifying injections, falsely called 'covid vaccines'.“ And while all the bioinformatics details are priceless (serines, S are phosphorylated while asparagines, N, glycosylated), one has to go beyond that.
The ONE UNIVERSAL SPIKE protein and its genome, injected in whatever form across the entire globe into human bodies, a product of biotechnology and biosynthetics, is now connected to other biotechnology steps taken by the governments, all in the same time. Knowing how many new cancers are being diagnosed after the covid injections, this new announcement with the title “How CRISPR therapy could cure everything from cancer to infertility“ is coming ‘so on time’, it is all available at:
And how about preparations for further genetic injections with an example at:
https://health.maryland.gov/phpa/OIDEOR/IMMUN/Shared%20Documents/ImmuNet_CRISP-Onboarding.pdf
How about synthetic known a priori digital biotechnogy with an example at:
https://horizons.gc.ca/en/2022/05/31/biodigital-today-and-tomorrow/
Is the technology which allows these plans already out there? Apparently yes:
https://all3dp.com/4/berkeley-scientists-3d-print-a-liquid-magnetic-device/
no more fixed magnets but rather flexible magnetic fluids, remotely controlled. And if so advanced new technologies are out there, who would benefit by using them? How about the clueless, poorest (thus at least influential) living in spaces ready to be exploited and tested upon:
Yes, the plan is out there, but we have to resist it all, while seeing through it, on time.
In the last section of this post I’d like to point again to publication ^10 dealing with platinum resistance in cancer, involving the PACSIN3. The phosphoprotein encoded by that gene participates in endocytosis and lipid binding and like all kinases is heavily phosphorylated on serines(S) and threonines(T). Phosphorylation, a reversible posttranslational modification of a protein is the only moment of adding phosphor atom at specified positions on those 2 surface exposed amino acids, while generating negative charge on that protein. Similarly DNA is negatively charged, but permanently, thanks to the fixed phosphate groups on its every segment. DNA’s conductivity changes upon methylation which in turns drives on/off expression of such labeled genes. The transient phosphorylation performed by the kinases changing the charge of a protein, leads to confirmational changes, coupled with changed functions, all reversible. And applying basics of physics to it, even the largely reduced electromagentics laws, will predict, every moved charge generates EMF fields and also the opposite, the EMFS will affect the moving charges. And since related PACSIN2 spreads HIV^12, and we know HIV-1 Gag protein has similarities to Spike, would there be anything in common? For the heck, here BLAST similarities between SARS-CoV2- Spike and human PACSIN2 (https://www.uniprot.org/uniprotkb/Q9UNF0/entry):
16.2 bits(30) 7.5 Compositional matrix adjust. 8/39(21%) 21/39(53%) 3/39(7%)
Query 1148 FKEELDKYFKN---HTSPDVDLGDISGINASVVNIQKEI 1183
F+E+ ++F+ +DL +++G A ++++ I
Sbjct 236 FEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSI 274
Query 809 PSKPS 813
PSKPS
Sbjct 338 PSKPS 342
Query 1150 EELDKYFKNH 1159
E+L + NH
Sbjct 281 EDLRWFRANH 290 or maybe that section this way:
Query 1150 EELDKYFK-NH 1159
E+L ++F+ NH
Sbjct 281 EDL-RWFRANH 290
Query 1004 LQTYVTQQLIRAA 1016
++ QQL A
Sbjct 51 IEKAYAQQLTEWA 63
and while PACSIN2 (Sbjct) and PACSIN3 (Query) are >50% identical and align for example like this the tiny SARS-CoV-2 section at the end of the table below speaks for itself… 5 conserved consecutive charges are not very common in proteins:
Query 362 AATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVEC
+ T VRVRALYDY GQE DELSF+AG+EL KM +EDEQGWC+G+L +G++GLYPANYVE
Sbjct 425 SGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEA
a very important section of Spike: CKFDEDDSEPVLKGVKLHYT
fits quite well (small shifts result in 5 negative and 3 positive charges overlap!) with both of the PACSIN's.
and many more homologous sections, as usual. A search for any publication relating SARS-CoV-2 Spike with PACSIN2 ends with nothing, except for different kinase^13, NUAK family SNF1-like kinase 2, with uniprot entry at: https://www.uniprot.org/uniprotkb/Q9H093/entry describing its function following way:
ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
This stress-activated kinase involved in tolerance to glucose starvation, induces cell-cell detachment by increasing F-actin conversion to G-actin.
When looking at BLAST alignment of covid Spike with this protein, also quite remarkale sections are appearing, with the last Spike section from above being the first below, for the 2 different kinases:
18.5 bits(36) 2.1 Compositional matrix adjust. 7/19(37%) 10/19(52%) 0/19(0%)
Query 1244 LKGCCSCGSCCKFDEDDSE 1262 Covid Spike
L+GC S + +E SE
Sbjct 568 LRGCVSVDNLTGLEEPPSE 586 HUMAN_NUAK 2
Query 362 VADYSV--LYNSASFSTFKCYG---VSPTKLNDLCFTNVYADSFVI 402
+AD+ + LY+ F C SP +N +T DS+ +
Sbjct 191 IADFGLSNLYHQGKFLQTFCGSPLYASPEIVNGKPYTGPEVDSWSL 236
Query 1132 IVNNTVYDPLQPELDSF 1148
IVN Y PE+DS+
Sbjct 220 IVNGKPY--TGPEVDSW 234
Query 1157 KNHTSPDVD 1165
K +T P+VD
Sbjct 224 KPYTGPEVD 232
and now one fragment of ~100 residues in one chunk:
Query 512 VLSFELLHAP---ATVCGPKKSTNLVKNKCVNFNFNGL-TGTGVLT-----ESNKKFLPF 562
V SF HAP +T G ++ +L K++ N L + T T +SN K LP
Sbjct 350 VCSFFKQHAPGGGSTTPGLERQHSLKKSRKENDMAQSLHSDTADDTAHRPGKSNLK-LPK 408
Query 563 QQFGRDIADTTDAVR-DPQTLEILDITPCSFGGVSVITP 600
+ ++ + + V+ DP L + P S G + + P
Sbjct 409 GILKKKVSASAEGVQEDPPELSPI---PASPGQAAPLLP 444
Query 144 YYHKNN 149
++HK+N
Sbjct 43 HHHKHN 48
and while the above does not look random, there is this issue where one of he above segments could also be aligned this way, in order to achieve alignment of the NUAK segment causing ‘its activation by phosphorylation on Thr-208 *‘:
Query 362 VADYSV--LYNSASFS-TFKCYG---VSPTKLNDLCFTNVYADSFVI 402 Spike
+AD+ + LY+ F TF C SP +N +T DS+ +
Sbjct 191 IADFGLSNLYHQGKFLQTF-CGSPLYASPEIVNGKPYTGPEVDSWSL 236 NUAK
*
Functions of NUAK 2 inlude: ATP-binding, Magnesium, Metal-binding, Nucleotide-binding, all dependent on the NF-kappa B, exactly the same protein hijacked by coronavirus.
HIV-1 gp-160 and Spike share the common W (Trp) section, and now that share is also with NUAK 2:
IKWPWYIWLGF SARS-CoV-2 Spike
+W W W G+
SHW-WVNW-GYATR NUAK 2
NUAK 2 interacts with 45 other proteins and despite of that, the researchers at ^14 state, quote: “The Heidelberg scientists blocked NUAK2 in the cells and observed reduced infection of cells by SARS-CoV-2 particles. In subsequent studies, the scientists found that NUAK2 regulates the amount of ACE2, the receptor for the virus, on the cell surface. "In addition, our studies showed that increased NUAK2 levels in infected cells increased the number of receptors in uninfected cells as well. As a result, these cells also became more infected with SARS-CoV-2.“
Since NUAK 2 plays also a key role in neural tube closure during embryonic development, ANY synthetic changes, in particular its inhibition (the usual strategy of pharma cartels) on that protein will affect that process.
Literature.
T C Theoharides, P Conti “Be aware of SARS-CoV-2 spike protein: There is more than meets the eye“ J Biol Regul Homeost Agents. 2021 May-Jun;35(3):833-838.
Ives Charlie-Silva et al. “Toxicological insights of Spike fragments SARS-CoV-2 by exposure environment: A threat to aquatic health?“ J Hazard Mater. 2021 Oct 5;419:126463. https://pubmed.ncbi.nlm.nih.gov/34216962/
M. Kucia et al. “An evidence that SARS-Cov-2/COVID-19 spike protein (SP) damages hematopoietic stem/progenitor cells in the mechanism of pyroptosis in Nlrp3 inflammasome-dependent manner.” Leukemia volume 35, pages 3026–3029 (2021)
https://www.salk.edu/news-release/the-novel-coronavirus-spike-protein-plays-additional-key-role-in-illness/
Bianca H. Ventura Fernandes et al. (+ 64 other authors!!!) “Toxicity of spike fragments SARS-CoV-2 S protein for zebrafish: A tool to study its hazardous for human health?“ Sci Total Environ. 2022 Mar 20; 813: 152345.
Yangzhuo Gu, et al. “Incorporation of a Toll-like receptor 2/6 agonist potentiates mRNA vaccines against cancer and infectious diseases“ Signal Transduct Target Ther. 2023; 8: 273. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10350459/
Luca Perico et al. “SARS-CoV-2 spike protein induces lung endothelial cell dysfunction and thrombo-inflammation depending on the C3a/C3a receptor signalling“ Sci Rep. 2023; 13: 11392. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10349115/
Vivek P. Chavda, et al. “mRNA-Based Vaccines and Therapeutics for COVID-19 and Future Pandemics“ Vaccines (Basel). 2022 Dec; 10(12):2150. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9785933/
Ellen A. M. Schenk‐Braat et al. “Gene therapy in The Netherlands: highlights from the Low Countries“ J Gene Med. 2007 Oct; 9(10): 895–903. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7167156/
Gwan Hee Han et al. “RNA sequencing and bioinformatics analysis revealed PACSIN3 as a potential novel biomarker for platinum resistance in epithelial ovarian cancer“ J. Gene Medicine Volume24, Issue11 November 2022 https://onlinelibrary.wiley.com/doi/10.1002/jgm.3452
Vincent Dumont 1 and Sanna Lehtonen “PACSIN proteins in vivo: Roles in development and physiology“ Acta Physiol (Oxf). 2022 Mar; 234(3): e13783. https://pubmed.ncbi.nlm.nih.gov/34990060/ and https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9285741/
Sergei Popov et al. “HIV-1 gag recruits PACSIN2 to promote virus spreading“ https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6142272/
Vibhu Prasad et al, Enhanced SARS-CoV-2 entry via UPR-dependent AMPK-related kinase NUAK2, Molecular Cell (2023). DOI: 10.1016/j.molcel.2023.06.020https://phys.org/news/2023-07-infection-mechanism-sars-cov-.html
https://phys.org/news/2023-07-infection-mechanism-sars-cov-.html
In the era of the previous biolab disaster, Morgellon's (after which the CDC quietly relocated gain-of-function labs overseas to places like Wuhan and Ukraine), there were so many microbiologist sudden deaths that lists documenting hundreds of names and suspicious circumstances were circulating.
GREAT post. I may edit for brevity and repost it. Thank you for the work you are doing.