The importance of D-Uridine, the nicotine and the lost senses.

Update 26/6/2023 : Angiotensin and nicotine issue seems to be more complicated than we think, but in the end effect nicotine does play a role in the ACE2 pathway. Here a scheme published in https://journals.physiology.org/doi/epdf/10.1152/ajpregu.00099.2018 explaining the dependencies little bit more:

Will end with one question for Dr. Ardis, who recently pointed to the newest NIH publication at https://pubmed.ncbi.nlm.nih.gov/37061001/ finally admitting a relationship between nicotine and the universally injected Spike toxin:

-what is the difference between the symptoms of issues with ACE2 in comparison with α7 nicotinic acetylcholine receptor? Which are more related to heart and blood issues? Look at uniprot would suggest it is ACE2, in my opinion…

Update: 2/4/2023 and 2/13/2023 New health documentaries, currently 5th video at https://absolutehealingseries.com/episode-5-live are presenting way MORE information about nicotinic acid used by increasing amount of MD’s (Dr. Bryan Ardis No 1 message!) in regard to affecting the side effects of the SARS-CoV-2 toxic Spike protein binding to the key protein, which is the α7 nicotinic acetylcholine receptor implicated in long-term memory (that would be smell too…).

Update: 12/20/2022 An old short now expanded analysis of covid19 vaccines patented by Novavax overlapping with newest Monsanto patents for plants gene ‘enhancement’. The overlap covers the widely known furin site.. At the very end of this post.

---

One of the devoted readers of my posts, THANK YOU Sally, suggested re-posting the most recent post with the information I added quite a while after sending it away to everybody. It was about supplementing with the enantiomer of the normal RNA constituent, uridine, i.e. D-uridine:

Where did the iron go*, the dopamine and uridine issue with SARS-CoV-2 toxic Spike protein and the mindless science, leading to more thoughts on 'Died Suddenly'. A link to Bing LIU?

The fact that all the mod mRNA based covid injection materials (Pfizer/Mod-E-RNA) contain a synthetic version of uridine, the s.c. N1-methylpseudouridine:

is not only making the entire scenario of covid infection with virus carrying the natural Spike absolutely not comparable with the functional features of the SYNTHETIC Spike encoded in human bodies after the genetically modifying injections, but equally it introduces a new dimension to the HUMAN genetics. We’ve been told that the synthetic genetic Spike material in covid injections^1 :

-decreases its immunogenicity, while evading Toll-like receptors

-there is no activation of cell surface, endosomal, and cytoplasmic viral RNA sensors (which is equivalent with slow or sudden, in case of death, annihilation of normal immune reaction of the human body)

-produces more than 10x the amount of the synthetic toxic Spike in every ‘transfected’ cell.

What that publication admits to is, that the synthetic Spike gene gets very efficiently reverse transcribed into cDNA using avian myeloblastosis virus (AMV) and Moloney murine leukemia virus (M-MLV) reverse transcriptases(RT). Unfortunately the team didn’t test HIV-1 RT... Additional problem arises with the presence of FOUR Pro-Pro dipeptides inside of the synthetic Spike amino acid sequence, in comparison to the 3 present in its natural form. According to the MEROPS data base (https://www.ebi.ac.uk/merops/cgi-bin/specsearch.pl), these peptides can only be digested by specific Dipeptidases, present in only specific bacteria, or neurolysin. Gluten intolerance is one of the major issues in those who already suffer the s.c. DPP IV deficiency, connected to the following physiological consequences, which according to that data base are: involvement in T-cell activation, cell adhesion, digestion of proline containing peptides in the kidney and intestines, HIV infection and apoptosis, and regulation of tumorigenicity in certain melanoma cells (Pethiyagoda et al., 2001). Amongst the important activities is the destruction of the insulinotropic hormone, glucagon-like peptide 1 (GLP-1) (Holst & Deacon, 1998; Deacon & Holst, 2002).”

So is it all about the stability of the synthetics or something else? The above picture suggests that the synthetic m1Ψ must have also different optical properties, essential in biophotonics. Looking at the RNA code table:

one can’t escape the thought, that almost every single amino acid attached to the long string of the translated synthetic Spike must ‘somehow’ be affected by that synthetic genetic(from hell) messenger.

We know that the replaced natural uridine is an essential building block of RNA, without which no protein, hormone, neurotransmitter, the entire organic world would exist. No biological process including neuroprotection, biochemical modulation and glycolysis can work without it. There is an implication that it represents a neuroactive molecule (https://feedabrain.com/uridine-article/)

So why on earth scientists introduce synthetics for something what is SO essential and start using it for genetic reprogramming of the entire human body?

Scientists are finding^4 that, just 3 quotes:

• uridine levels are lower in the COVID-19 groups as compared to the healthy and non-COVID-19 groups. Uridine is a biologically dynamic metabolite that is critical to the synthesis of RNA and glycogen.

• In an animal model of pulmonary fibrosis, it was shown that uridine supplementation has anti-inflammatory and anti-fibrotic effects.

• metabolism of glucose has been linked with the metabolism of uridine and citrulline. Specifically, uridine has been shown to induce glucose uptake by skeletal muscles and increased levels of citrulline in the plasma is associated with a reduction in glucose production. Regardless of the biological significance, the correlation of uridine and citrulline with glucose points towards these metabolites being modest candidates for COVID-19 severity biomarkers.“

But already in 1985 it was known^2 that natural uridine from the blood enters CSF (cerebrospinal fluid), gets phosphorylated and then incorporated into RNA or further catabolized. Roberts C.A. reported in Brain Res. 1973 (55:291–308) about “Anticonvulsant effects of uridine: comparative analysis of metrazol and penicillin induced foci”. PubMed literature about uridine goes all the way back to ~1950 with over 61,000 entries and when looking for a RNA biodistribution searching with the string ‘mRNA profiling‘, one gets ~322,000 publications. So scientists know a LOT about uridine, just do not seem to share enough and tragically completely ignore their wisdom now while feeding humanity with their new ‘replacement’, a patented supertoxins..?

In 2017 group of scientists showed^5 on animal model that uridine regulates mucin production and up-regulates water content capacity in the transverse colon and down-regulates the mAChRs signaling pathway. mAChRs stands for the Muscarinic Acetylcholine Receptor(s), one of the first cloned and sequenced neuro-receptors (No 1 NIH interest), with work on it preformed by the co-father of genetic sequencing, Craig Venter^6. In one of his books “Life at the speed of light“ Venter came up with a question: ”Could we harness the same DNA-repair mechanisms to build a synthetic genome? He was talking about Deinococcus radiodurans R1, a bacterium which can stand three million rads of ionizing radiation, 6000x more then we humans can, just showing the unlimited potentials of his ‘synthetics’ ideas, called ‘revolutionary’ by his own Insitute. Craig Venter also worked on Nicotinic acetylcholine receptors (nAChRs), acetylcholine/nicotin-gated ion channels representing: muscle receptors(muscle contraction), found at the skeletal neuromuscular junction where they mediate neuromuscular transmission, and neuronal receptors, found throughout the peripheral and central nervous system where they are involved in fast synaptic transmission (thinking, memories).

C. Venter’s Center specializes in analysis of whole blood RNA-sequencing and single cell RNA-sequencing among others, they looked very much in depth into data from HepB vaccinated people in 2020^6a, looked very much into peripheral blood of infants reacting to RSV matrix proteins using again RNA-sequencing^6b, all partly paid by NIAID, and yet, there was a total silence in response to what happens in bodies of victims after covid gene modifying injections, while introducing totally new elements into BILLIONS of human bodies. WHY do they investigate the natural mRNA distribution in human bodies and then keep totally quiet when introducing IN REAL TIME of an ‘emergency’ the synthetic machinery across this clueless wolrd????

What Venter investigated in 80’s, that’s the same receptor family affected by Ivermectin, the macrocyclic lactone, which acts as a positive allosteric modulator of the alpha7 nicotinic acetylcholine receptors (nAChRs)^7.

The neurotransmitter Acetylcholine (ligand for both the above mentioned receptors) among its fundamental role in synaptic plasticity, memory, cognition, learning, neurological diseases also participates in breathing control, too much of it, if not metabolized, short-circuits the nervous system, the diaphragm gets paralyzed and victim suffocates. Nicotine, while binding to the same nACh receptor for example placed in brain, increases the use of dopamine, part of the “reward pathway”, known to all smokers. Studies also reveal that cancer cell processes such as proliferation, apoptosis, angiogenesis and even epithelial-mesenchymal transition (EMT) all are mediated by overexpression of AChRs in different kinds of tumors^8. And with every overexpression of an receptor, comes also binding of their ligands, (in case of AChRs) like nicotine, like choline, all found in NATURAL products (tobacco, eggs, milk, cheese, etc). The supply of the ligands must clearly affect the further production of these receptors themselves in order to build a regulation loop, keeping in check the entire process of neurotransmission.

In Nov 2020 an international team of researchers found out that the SARS-CoV-2 Spike proteins interacts with the nicotinic acetylcholine receptors via its short section covering exactly its special furin site, the sequence Y674-R685 representing: YQTQNSPRRAR^8a .

And all that depends on the availability of uridine, the basic brick of RNA. It is hard to imagine the consequences of that synthetic modification and disruption of the entire NATURAL uridine circuitry during the genetic reprogramming introduced by the ILLEGAL, thus CRIMINAL, covid injections.

IN regard to the above receptors, Covid19 era introduced another dispute among scientists. One group insists that nicotine interferes with the same receptors SARS-CoV-2 does^9 and thus have therapeutic potential, and the other one, looking at the issue from the “vaccines”(experimental gene treatments) point of view, which claims otherwise^10. If you look at the country No1 to watch what covid19 tyrannies can do, a title like this one:”New Zealand passes world-first tobacco law to ban smoking for next generation” can point you to an idea, as to which group represents whose interests. The above Nov 2020 paper^8a states explicitly, quote:”If nicotine does indeed prove to have any clinical value, it is likely that it would be due to interfering with the association with nAChRs. If so, nicotine analogs (e.g., smoking cessation agents such as varenicline (92), cytisine (93), and, potentially, cytisine variants (55)) could also find a useful application for COVID-19.”

The loss of smell and taste, which seem to be a part of our MEMORIES, after a severe covid19 disease, or the old style flu, can be extremely frustrating, and longlasting. One of the reviews pointing to some remedies^11 illustrates the known way in the pathway involved in these precious senses:

The importance of smell can be only realized once it is gone, and so was my case. A single smell of a flower from a blooming acacia tree in 2019, brought my memories back as a 3 years old child!! It was incredible, all that in the good old pre-covid times, just before the disaster. After almost complete loss of smell and part of taste, for the last 1.2 years, and trying about almost everything natural (not the drugs though) from the table 1. in the ^11, the hope was gone, until I listened to Dr. Bryan Ardis’ solution (https://thedrardisshow.com/dr-bryan-ardis-d-c), a nicotine chewing gum. 2 mg a day appears to be a lot for non-smokers, BUT lowering even that amount in multiple doses, with the usual daily addition of 50mg of zinc, NAC and VitC brought the smell not yet 100%, but already to a substantial level. That’s priceless, after 1.2 years of confusion, even for the price of ingesting some other not disclosed chemicals present in these nicotine gums! Currently there is a new trend, by a GROWING NUMBER of medical truthful covid experts, and its name is: application of nicotine patches!

Why nicotine:

works, while the caffeine suggestion, from the cited paper, does not?

Maybe Dr. Richard Tubb^12 has the answer? That was the personal physician to President George W. Bush, the one who distributed ‘cipro’ (ciprofloxacin), anti-anthrax drug around 9/11, (way in advance, before others who received the anthrax contaminated letters died), and who in 2013 became the member of Board of Directors of British American Tobacco Company, affiliated with Kentucky BioProcessing, the one which today produces covid19 ‘vaccines’ from genetically modified tobacco plants:

https://www.nationalgeographic.com/science/article/your-next-vaccine-could-be-grown-in-a-tobacco-plant

Let’s keep every single tobacco seed deep in the earth, in a private little seed vault, not the one owned by Gates et al. deep in Norway: https://www.seedvault.no/

THANK YOU again Dr. Ardis for that nicotine tip! Smell and memories are too precious to be lost. All the supplements didn’t do their job without the nicotine, and of course the receptors binding it, somewhere in the body, again all not possible without the D-uridine, but most importantly, all of it absolutely not possible without the original CREATOR.

The foods rich in choline, the acetylcholine precursor, all agonists of the nAChRs, look like this:

Sally’s remark from previous post about: What Foods Contain Uridine? Uridine is found in beets, sugar beet molasses, broccoli, liver, tomatoes, beer, brewer's yeast, and walnuts.

The only little thing, I’d add here, is a small piece of nicotine chewing gum, the purest one can get:))) Not the one from the new patented genetically modified tobacco plants. And also too much of the beer, can confuse the senses too:)

The last here re-posted post went into more details regarding uridine supplementation, clearly worth to investigate, in particular when the synthetic chemically modified uridine is present.

AND THANK YOU for reading, in case you got that far:) In case you read some of my previous posts with quite a bit of bioinformatics in it, here a small addition, inspired by the latest lecture of Dr. Heiko Schoening, presented in the last video posted at:

https://uncutnews.ch/neue-und-interessante-videos-wenn-sex-mit-kindern-legal-werden-soll-ii-mit-dieser-aussage-haben-sie-sich-verraten-ii-alcyon-pleyaden-extra-36-ii-michael-lueders-heiko-schoening-und-mehr/

The keyword with which he starts is ‘Novavax’ and the name Dr. Michael A. Mcmanus in connection with heroin and weapons industry. Here an alignment of a small segment of the injected SARS-CoV-2 Spike amino acids with piece of the recently recently by Monsanto patented “Genes and uses for plant enhancement” Patent: US 10696975-B2 30177 30-JUN-2020; (ncbi code QPU39845.1). Sbjct line is SPike2020 sequence, Query the Monsanto’s or Novavax latest patents:

19.6 bits(39) 0.39 Composition-based stats. 18/55(33%) 22/55(40%) 9/55(16%)

Monsanto's patent sequence in Query line, Sbjct is Spike:
Query  236  AYEPVWAIGTGKVASPQQAQEVHVAVREWLSKNVSAEVASQTRIIYGGSVNGGNS  290
            +YE    IG+G  AS Q             S   +  VASQ+ I Y  S+   NS
Sbjct  659  SYECDIPIGAGICASYQTQTN---------SPRRARSVASQSIIAYTMSLGAENS  704
                                   Spike's FURIN SITE!!!!!!

And now the NOVAVAX patented covid vaccine over the same Spike2020
Query 672 ASYQTQTNspqqaqsvasqsiiaYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSM 
          ASYQTQTNSP++A+SVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSM
Sbjct 672 ASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSM 731
=>Almost all covid injections carry the original Spike sequence with the 'prrar' segment in them from the Sbjct line(Moderna, Pfizer, etc). So doesn't it looks like the Q->R mutation, or maybe the opposite, must have some purpose in order to jump from a virus to a new synthetic plant???

Since the Spike2020 is PATENTED, and so are Monsanto’s new plants, the question is, are people being injected with patented viral or plants parts actually??? Looking at this special Novavax covid vaccine fragment ‘spqqaqsvasqsiia‘ (QXC69972.1 NIH code), replaced in all others modmRNA based genetically modifying covid products by ‘SPRRARSVASQSII’and the similarity of that very same fragment in Monsanto patent encoding for the new GMO plant QPU39845.1 protein, here its BLAST alignment:

16.9 bits(42) 2.8 9/23(39%) 12/23(52%) 0/23(0%)

Query  667ASYQTQ--TNSPQQAQSVASQSIIAYTMSLGAE  689 Novavax Corona Spike
          A+  T   + SPQQAQ V        + ++ AE
Sbjct  25 AI-GTGKVA-SPQQAQEVHVAVREWLSKNVSAE  272 MONSANTO patent
and so many other fragments like:
Query  671  AQSVASQSIIAYTMSLGAENS  691 Novavax Corona Spike QXC69972.1
            +  VASQ+ I Y  S+   NS
Sbjct  270  SAEVASQTRIIYGGSVNGGNS  290 MONSANTO patent QPU39845.1
which when changing BLAST algorithm can end up with 
23.8 bits(48) 	0.024 	15/41(37%) 	16/41(39%) 	16/41(39%)
Query  250  SPQQAQEVHVAVREWLSKNVSAEVASQTRIIYGGSVNGGNS  290 'Vaccine'
            SPQQAQ                 VASQ+ I Y  S+ + NS
Sbjct  667  SPQQAQ----------------SVASQSIIAYTMSLGAENS  691 GMO plant
clearly implicate no randomniss in that fragment with some function... 

one gets into more questions. The things get stranger when checking all that with an old Hemophilus Influenza protein (NIH code at https://www.ncbi.nlm.nih.gov/protein/ABQ99175.1 ) phospho-2-dehydro-3-heoxyheptonate aldolase, a predicted choline kinase involved in LPS biosynthesis with that incredible sequence posted here already couple of times on multiple occasions:

MQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQ
IVGFVKTCYKPEEVFHFLHQNSIPFSSIGGMTNQNVLLNISGIKFVLRIPNAVNLSLINREYEAFNNAQA
YRAGLNVETPVLDAKSGVKLTRYLENSKPLSQIQLNEQSCLSQVVNNLYRLHNSEFVFRNVFSVFDEFRQ
YFSLLENKSAFYQADSKMDKLSAVFWQFEEINKEIILRPCHNDLVPENMLLQDDRLFFIDWEYSGLNDPL
FDIATIIEEAHLSKEAADFLLETYCNQTNKYHKTEFQIAHKRLKIHRFCQNVLWFLWTKVKEEHGENFGD
YALKRLDAAFKLLEELP

When comparing that who knows how old sin-ful protein with the patented Spike from Novavax one gets again, huge amount of common smaller peptides, here some examples:

21.4 bits(43) 0.16 5/7(71%) 6/7(85%) 0/7(0%)

Query  178  EFVFKNI  184   QXC69972.1 Novavax patent US 10953089
            EFVF+N+
Sbjct  195  EFVFRNV  201   ABQ99175.1 (amino acid) 
Query  437  NYLYRL------FR  444
            N LYRL      FR
Sbjct  186  NNLYRLHNSEFVFR  199
Query  1155  DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYE  1194
             +ISGI   V  I       N V  NL  SLI+  E   YE
Sbjct  109   NISGIK-FVLRIP------NAV--NL--SLIN-RE---YE  133
Query  942  NAQA----LN  947
            NAQA    LN
Sbjct  137  NAQAYRAGLN  146
Query  327  EVF-----NATRFASV  337
            EVF     N   F S+
Sbjct  83   EVFHFLHQNSIPFSSI  98
Query  672  QSVASQSI  679  <<< 
            QS+  QSI
Sbjct  34   QSI-NQSI  40  <<<<<8 of those SIN sections
Query  672  QSVASQSIIAYTMSLGAENSVAYSNNSI  699 insertion in covid SPike
            QS+  QSI                N SI
Sbjct  18   QSI-NQSI----------------NQSI  28
Query  636  CLIGAEHVNNSY  647
            CL   + VNN Y
Sbjct  180  CL--SQVVNNLY  189
Query  892  RFNGIGVTQNVL  903
            RF      QNVL
Sbjct  327  RF-----CQNVL  333
Query  102  QSLLIVNNATN-VV--IKVC----E-FQF  122
            QS   +N   N +V  +K C    E F+F
Sbjct  62   QS---INQSINQIVGFVKTCYKPEEVFHF  87
BLAST won't align the aromatic tryptophans, so essential, so manual try:
   QYIKWPWYIWLGFIAGL     Spike 
   Q + W  ++W
   QNVLW--FLWTKVKEEHGEN  Haem Infl.

The new covid19 seemed like the old flu in 2020… Just the Haemophilus influenzae PittGG strain is not a virus, it is a bacterium….

No matter what, PLEASE warn every single fellow human about the incredible evil related to covid gene modifying injections, in particular since their connection to Monsanto, implies already nothing good behind it.

Would like to end with citing more of the OLD papers dealing with SARS-CoV-2 Spike and nicotine:

-Nicotinic Cholinergic System and COVID-19: In Silico Identification of an Interaction between SARS-CoV-2 and Nicotinic Receptors with Potential Therapeutic Targeting Implications. Farsalinos K, Eliopoulos E, Leonidas DD, Papadopoulos GE, Tzartos S, Poulas K. Int J Mol Sci. 2020 Aug 13;21(16):5807. doi: 10.3390/ijms21165807. PMID: 32823591

- The SARS-CoV-2 Virus and the Cholinergic System: Spike Protein Interaction with Human Nicotinic Acetylcholine Receptors and the Nicotinic Agonist Varenicline.

Carlson EC, Macsai M, Bertrand S, Bertrand D, Nau J. Int J Mol Sci. 2023 Mar 15;24(6):5597. doi: 10.3390/ijms24065597. PMID: 36982671

-Nicotinic cholinergic system and COVID-19: In silico identification of interactions between α7 nicotinic acetylcholine receptor and the cryptic epitopes of SARS-Co-V and SARS-CoV-2 Spike glycoproteins.

Lagoumintzis G, Chasapis CT, Alexandris N, Kouretas D, Tzartos S, Eliopoulos E, Farsalinos K, Poulas K. Food Chem Toxicol. 2021 Mar;149:112009. doi: 10.1016/j.fct.2021.112009. Epub 2021 Jan 24. PMID: 33503469

-Cholinergic dysfunction in COVID-19: frantic search and hoping for the best.

Nadwa EH, Al-Kuraishy HM, Al-Gareeb AI, Elekhnawy E, Albogami SM, Alorabi M, Batiha GE, De Waard M. Naunyn Schmiedebergs Arch Pharmacol. 2023 Mar;396(3):453-468. doi: 10.1007/s00210-022-02346-9. Epub 2022 Dec 3. PMID: 36460816

Literature:

1. Kyusik Q. Kim et al. “N1-methylpseudouridine found within COVID-19 mRNA vaccines produces faithful protein products” Cell Rep. 2022 Aug 30; 40(9): 111300. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9376333/

2. R Spector “Uridine transport and metabolism in the central nervous system”. J Neurochem. 1985 Nov;45(5):1411-8. https://pubmed.ncbi.nlm.nih.gov/3930662/

3. Yasuyo Urasaki1 et al. “Uridine Affects Liver Protein Glycosylation, Insulin Signaling, and Heme Biosynthesis.” PLOS ONE | www.plosone.org 1 June 2014 | Volume 9 | Issue 6 | e99728.

4. Ali Rahnavard et al. “Metabolite, protein, and tissue dysfunction associated with COVID‑19 disease severity” Scientific Reports | (2022) 12:12204 | https://doi.org/10.1038/s41598-022-16396-9.

5. Ji Eun Kim et al. “Uridine stimulate laxative effect in the loperamide-induced constipation of SD rats through regulation of the mAChRs signaling pathway and mucin secretion.” BMC Gastroenterology volume 17, Article number: 21 (2017)

6. F. Z. Chung, et al. and J. C. Venter. “Cloning and sequence analysis of the human brain beta-adrenergic receptor: Evolutionary relationship to rodent and avian beta-receptors and porcine muscarinic receptors.” FEBS Letters 211, no. 2 (January 26, 1987): pp. 200–206.

   6a. Rym Ben-Othman et al. “Systems Biology Methods Applied to Blood and Tissue for a Comprehensive Analysis of Immune Response to Hepatitis B Vaccine in Adults.” Frontiers in Immunology, Nov 2020, Vol 11, Article 580373

   6b. Juilee Thakar et al. ”Unbiased analysis of peripheral blood mononuclear cells reveals CD4 T cell response to RSV matrix protein” Vaccine: X 5 (2020) 10065

7. Toby Collins  1 , Neil S Millar “Nicotinic acetylcholine receptor transmembrane mutations convert ivermectin from a positive to a negative allosteric modulator“ Mol Pharmacol. 2010 Aug;78(2):198-204 https://pubmed.ncbi.nlm.nih.gov/20463059/

8. Jiawei Chen et al. “Acetylcholine receptors: Key players in cancer development” Surgical Oncology Volume 31, December 2019, Pages 46-53. https://www.sciencedirect.com/science/article/abs/pii/S0960740418304432

   8a. A. Sofia F. Oliveira et al. “A potential interaction between the SARS-CoV-2 spike protein and nicotinic acetylcholine receptors“ Biophysical Journal 120, 983–993, March 16, 2021 983

9. Yousef Tizabi  et al. “Nicotine and the nicotinic cholinergic system in COVID-19”. FEBS J. 2020 Sep;287(17):3656-3663.

10. Pietro Ferrara et al. “The Effect of Smoking on Humoral Response to COVID-19 Vaccines: A Systematic Review of Epidemiological Studies“ Vaccines 2022, 10, 303. https://doi.org/10.3390/vaccines10020303

11. Elnaz Khani et al. “Potential pharmacologic treatments for COVID-19 smell and taste loss: A comprehensive review”. Eur J Pharmacol. 2021 Dec 5; 912: 174582. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8524700/

12. ‘Game Over: COVID-19 I ANTHRAX-01’ by Heiko Schöning, Sep 2021.