Update 12/5/2023: NZ covid injections data exposed by COVID whistleblower Barry Young make huge news: https://www.brighteon.com/8723fded-a3eb-43f9-967c-188ed779971b while almost in the same time the ‘very tiny UK parliament’ invites few very important witnesses of covid crimes:
Update 12/9/2023: Amazing lecture by Dr. David Martin exposing all the crimes related to covid: https://www.bitchute.com/video/MMXfRHgFybqK/ Sept 12 2023 Live Stream - Anthroposophical society in Dornach Switzerland at the Eurythmeum“
The financial flow is always shedding some light on specific events, like for example the 2023 alphabetical list of support for the political Green Party in Germany, just published at:
with a source, in German though, at: https://report24.news/festival-der-doppelmoral-pizza-sause-sponsored-by-lufthansa-spott-und-hohn-nach-parteitag-der-gruenen/
The above is a very strange list, in which google, amazon, a non-german companies want to influence the german Green world. But then there is also Abbott Diagnostics with its ID NOW, the first CLIA-waived point-of-care molecular platform, also non-german company. So it is no wonder, that Lufthansa wants also more Green future, and Bayer AG too, and all the high tech companies, but why on earth ‘The Tooth and Mouth-health BW’ (IZZ) gives the highest donation and even worse, the contradicting to that Industrial SUGAR Association also throws in few pennies? Any sweet tooth results in high dental costs, so why the sugars are SO important, health-wise and otherwise?
It is a wide stretch, but maybe because of the posttranslational modifications of proteins, known as glycosylation??? Clearly in covid times it was extremely important topic^1,2,3,4,5 and tons more on that not only on PubMed, with the first publication showing which sugars actually bind to the covid Spike. The potential of the emerging field of ‘glycomedicine’ is enormous^6 and it becomes truly frightening, to me, to read Bayer’s AG/+Mon-SAN-To patent for their new sweet corn MESSENGER 10194622, for example at https://patents.google.com/patent/US10194622B1/en describing the changes in that crop, quote:
“the DNA coding sequences can affect these phenotypes by encoding a non-translatable RNA molecule that causes the targeted inhibition of expression of an endogenous gene, for example via antisense- or cosuppression-mediated mechanisms (see, for example, Bird et al., Biotech. Gen. Engin. Rev., 9:207, 1991). The RNA could also be a catalytic RNA molecule (i.e., a ribozyme) engineered to cleave a desired endogenous mRNA product (see for example, Gibson and Shillito, Mol. Biotech., 7:125, 1997). Thus, any gene which produces a protein or mRNA which expresses a phenotype or morphology change of interest is useful for the practice of the present invention.“
The statictics of the old Monsanto GMO sugar beets spread (plants glyphoste resistant, https://patentimages.storage.googleapis.com/05/70/ee/4f6f1a2e5b948e/US7335816.pdf), according to wiki, implied a super fast grow, almost like the Warp Speed 2020, just years back, quote: “In 2008/2009, 60% of the sugar beets grown in the US were GM. By 2009/2010, the percentage of GM beets had grown to 95%.[5][9]” That was thanks to the in 2003 filed patent US 7.355.816 B2. (http://www.monsantotechnology.com/content/genuity-traits-sugarbeets.aspx)
Given the ILLEGAL approval of ALL GMO’s, and the quiet approval trend in constantly higher levels of applied chemicals accompanying GMO’s on crop fields, there might be no ‘original versions’ of anything left, after the planned application of the CRISP genetic cuttings.. And that’s not all, GB goes ahead with the first CRISPed HUMAN, according to https://childrenshealthdefense.org/defender/uk-crispr-therapy-humans/. Btw. what a name, CRISP, just bite into it!
Back to the sweet topic. Which sugars are in sugar beets? Sucrose, a disaccharide with following 2D structure:
with the left non-flat ring-like being glucose, and the right fructose. The five-carbon sugar, s.c. pentose in DNA, the deoxyribose, in RNA ribose, have identical arrangements, with the exception of ONE oxygen atom difference, giving for example, the overall structure of the DNA gene segment (image taken from https://www.genome.gov/genetics-glossary/Phosphate-Backbone):
Table 1 in ^1 at https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8880561/ shows the types of sugars binding to the SARS-CoV-2 Spike and Tab. 2 shows the ‘The carbohydrate binding preferences of spike protein S1 and S2 subunits’ with an similar result in one of the meta-analysis studies^7 summarizing that issue, quote: “This meta-analysis shows associations between blood groups and SARS-CoV-2 infection and supports the hypothesis that blood type O may have a slightly lower risk of infection, whereas blood type A may have a slightly higher risk of infection.”
The types of sugars bound to the SARS-CoV-2 Spike^1 are all of the 6-carbon type, (hexoses type) belonging to glucose-, mannose-, fucose-, rhamnose-, lactose(galactose+glucose)-like or combinations thereof. Why there is no ribose or fructose, pentose-type on the Spike?? Is it maybe because it is glucose and not fructose, which stimulates pancreas to produce insulin?? And also maybe because cancer cells crave for glucose while having 15-17 more insulin receptors on their surface? That won’t be answered here, unfortunately, but for everything there is a reason, so more search is required;)
Which sugars are determining the blood types, related to immunologic reactions? N-acetylgalactosamine (A antigen) and D-galactose (B antigen), both hexoses, with the former one, also called GalNAc, playing a role in cancer^8. And another sugar, so hugely abundant in soy (https://pubmed.ncbi.nlm.nih.gov/12406739/), also in GMO soy, the Galactose-α-1,3-galactose causes equally trouble, rejection of human transplants, and the CDC blames only the poor animals’ meat for that. Here from CDC pages (https://www.cdc.gov/ticks/alpha-gal/index.html):
Alpha-gal (galactose-α-1,3-galactose) is a sugar molecule found in most mammals.
Alpha-gal is not found in fish, reptiles, birds, or people.
Alpha-gal can be found in meat (pork, beef, rabbit, lamb, venison, etc.) and products made from mammals (including gelatin, cow’s milk, and milk products).
But aren’t baby’s formulas frequently containing soy, stored behind the locked glass doors in every pharmacy, also the one contributing to the explosion of babies IgG’s within the first six months of their life? The Alpha-gal’s 2D structure:
is at least in terms of overall formula somewhat similar to the one of the highest bound sugars on S2 domain of Spike, which is melibiose^1. According to wi-ki:
“Melibiose is a reducing disaccharide formed by an α-1,6 linkage between galactose and glucose. It differs from lactose in the chirality of the carbon ... It can be formed by invertase-mediated hydrolysis of raffinose, which produces melibiose and fructose.” And its structure is:
In 2002 bacterial gene for alpha-Gal was discovered, which was regulated at the transcriptional level, i.e. induced by melibiose, the melA gene was from Lactobacillus plantarum (https://pubmed.ncbi.nlm.nih.gov/12406739/). Melibiose permease, the protein which binds and transports that sugar through the cell membrane, (https://www.uniprot.org/uniprotkb/P02921/entry ) mediates the transport of also other galactosides by a symport mechanism while using sodium, lithium and protons as coupling cations, depending on the sugar substrate and the cationic environment. Melbiose transport system research goes all the way back to 80-ies, including the 1989 PhD thesis work titled “Structure-Function Correlations of the Melibiose Carrier of Escherichia Coli” by Botfield M.C. at Harvard. No, sorry, melibiose history is much older (search on https://www.ncbi.nlm.nih.gov/pmc for melibiose and sort by pub date and start with the oldest). In 1935 Blank & Arnold from Harvard Uni. published an article titled: “The inhibition of growth of Bacillus Subtilis by Ultra-Violet irradiated carbohydrates” (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC543682/pdf/jbacter00807-0056.pdf)
So once the above sugars added to agarose and agropectin (so called agar plates), or just on their own were irradiated with 253.7nm, serving as the bacterial growing media, their irradiated byproducts completely inhibited the bacterial growth, i.e. duplication with every ~20min… The above table shows that the time of irradiation proportional to the toxic material to prevent the bacterial growth, after seventy-two hours incubation at 30'C, is the highest for mellbiose, raffinose, corn starch but for our luck, exceptional for glycogen. In other words, many good sugars, in particular D-glucose (our brain lives from it!), will be gone first, while many bad ones will still support the growing bacteria, except for the branched polymer of glucose, the glycogen. Question is, which bacteria in addition to this Bacillus species? Years back, I realized, that the only bacteria capable of degrading glyphosate, are the pathogenic ones, not the good ones, again, leaving them thriving, while the good ones are gone... All random or intentional?
The alpha-gal issue in human transplants is so huge, that in face of the human covid genetically modifying injections, FDA approved even GMO pigs. The first experiments were done in 2003 with knocked out alpha-gal gene (or GaIT-KO) in pigs using the nuclear transfer cloning (https://pubmed.ncbi.nlm.nih.gov/11778012/).
So what about SARS-CoV-2 Spike sugars?? According to uniprot entry for the Spike (https://www.uniprot.org/uniprotkb/P0DTC2/entry ), its following residues are glycosylated:
a) 17, 61, 74, 122, 149, 165, 234, 282, 331, 343, 603, 616, 657, 709, 717, 801, 1074, 1098, 1134, 1158, 1173, 1194, all on Asparagine (N) residues
b) 323, 676, 678, on Threonine(T) residues
c) 325 on Serine (S)
That’s a sugar-sponge with LOT of sugars, all protecting the Spike which infects and invades. The glycosylation ‘evolution’ between SARS-CoV and SARS-CoV-2 on these 2 examples with Query being the 2002 and Sbjct the 2020 Spike of SARS-CoV-2 virus:
*122
Query 114 VIIINNSTNVVIRACNFELCDNPFFAV----SKPMGTQTHTMIFDNAFNCTFEYISDAFS
++I+NN+TNVVI+ C F+ C++PF V + ++ ++ +A NCTFEY+S F
Sbjct 117 LLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFL
3 4 *149 *165
and around the furin site:
Query 643 DTSYECDIPIGAGICASYHTVS----LLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPT
+ SYECDIPIGAGICASY T + RS + +SI+AYTMSLGA++S+AYSNN+IAIPT
Sbjct 657 NNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPT
*657 7 *predicted^9 *709
9. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8513636/
indicates that for some sections new glycosylated asparagines were introduced.. A BLAST comparison of the SARS-CoV-2 Spike (Sbjct) with the melibiose permease (Query), gives a potential melibiose binding sites (by homology):
Query 365 ESIAYSVQTMVV 376 Melibiose permease NCBI code P02921.2
S+AYS ++ +
Sbjct 703 NSVAYSNNSIAI 714 SARS-CoV-2 Spike YP_009724390.1
* glycosyated Spike site
Query 37 VGLSVGLVGTLFLVARIWDAINDPIMGWIVNATRSRWGKFKPWILI------GTLANSV
+G+++ TL + R + D GW A G +P + GT+ ++V
Sbjct 231 IGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAV
* glycosylated Spike site
Query 80 ILIGTLANSV 89 Melibiose permease (MB)
++IG + N+V
Sbjct 1128 VVIGIVNNTV 1137 SARS-CoV-2 Spike
* glycosylated Spike site
Query 118 MTYTIMDIPFWSLVPTITLDKR 139 MB
+TY ++ P I D +
Sbjct 1065 VTYVPAQEKNFTTAPAICHDGK 1086 Spike
* glycosylated Spike site
Query 102 GTTQIVFVCVTYILWGMTYTIMDIPFWSLVPT 133 MB
GT V V Y T + I L PT
Sbjct 601 GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPT 632 Spike
* glycosylated Spike site
Query 150 FFASLAGF 157 MB
FF+++ F
Sbjct 58 FFSNVTWF 65 Spike
* glycosylated Spike site
Query 204 VFSSDNQPSAEGSH 217
++S+N S G +
Sbjct 435 AWNSNNLDSKVGGN 448
and the special Spike and HIV fragment, aligning partly with melbiose
Query 142 EQLVPYPRF--FASLAGFV 158
EQ + +P + +AG +
Sbjct 1207 EQYIKWPWYIWLGFIAGLI 1225
This is a short story based just on few older publications, but given the first sentence of the 1935 print, quote: “While investigating the killing of the spores of the anthrax bacillus by sunlight, Roux (1887) came to the conclusion that germination of the spores could be inhibited by materials which were formed as a result of the oxidation of the carbohydrate fraction of the medium. “, there must be way more knowledge out there.
If there is one point here, that would be: limit your sugars intake;), at least not to feed the Spike, also because all is paid for by politicians.
Last but not least, how many and WHICH sugars are actually measured in case of diabetes tests?? The sweet TASTE of many synthetic compounds in comparison to the taste of refined sugar, the substances, which will never leave the human body, according to Focus issue no 44, are the following:
Synthetic Sugar | Its E-number. | how many times sweeter than sugar
Acesulfam | - | 350
Advantam | E969 | 20,000-37,000
Advantam2 | E962. | 200
Cyclamat | E952 | 35
Neohesperidin | E959 | 400-600
Neotam | E961. | 7,000-13,000
Saccharin | E954 | 300-500
Stevia |. E960. | 200
Thaumatin. |. E957. | 2,000-3,000
Thank you, as always for reading and checking in, without ID NOW tests, passports, etc. Also the sub-stack limit is there…
Literature:
1. Yung-Kuo Lee et al. “Carbohydrate Ligands for COVID-19 Spike Proteins” Viruses. 2022 Feb; 14(2): 330. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8880561/
Tingting Feng et al. “Glycosylation of viral proteins: Implication in virus–host interaction and virulence“ Virulence. 2022; 13(1): 670–683. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9037552/
Amanda E. Dugan et al. “Advances in glycoscience to understand viral infection and colonization.” Nature Methods volume 19, pages 384–387 (2022) https://www.nature.com/articles/s41592-022-01451-0
Vijay Kant Pandey et al. “N-glycosylation, a leading role in viral infection and immunity development.” Molecular Biology Reports (2022) 49:8109–8120 https://link.springer.com/article/10.1007/s11033-022-07359-4
Colin Reily et al. “Glycosylation in health and disease.” Nature Reviews Nephrology volume 15, pages 346–366 (2019). https://www.nature.com/articles/s41581-019-0129-4
Federico Banchelli et al. “The Role of ABO Blood Type in Patients with SARS-CoV-2 Infection: A Systematic Review” J Clin Med. 2022 Jun; 11(11): 3029. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9181227/
R. Aguado et al. “Unveiling the Shape of N-Acetylgalactosamine: A Cancer-Associated Sugar Derivative”. J. Phys. Chem. A 2022, 126, 42, 7621–7626. https://pubs.acs.org/doi/10.1021/acs.jpca.2c04595
Not organized material, an additional literature to consider, related to this post:
Biosynthesis of α-Gal Epitopes (Galα1-3Galβ1-4GlcNAc-R) and Their Unique Potential in Future α-Gal Therapies. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8601398/
Beyond Shielding: The Roles of Glycans in the SARS-CoV‑2 SpikeProtein. Lorenzo Casalino at al. https://pubs.acs.org/doi/epdf/10.1021/acscentsci.0c01056
diabetes tests: https://diabetesjournals.org/care/article/26/1/163/22514/Discordance-Between-HbA1c-and-FructosamineEvidence
“Primary Structure and Characteristicsof the Melibiose Carrier of Klebsiella pneumoniae 1992
Characterization of the melA Locus for -Galactosidase in Lactobacillus plantarum by Aurelio Silvestroni 1992 https://www.ncbi.nlm.nih.gov/pmc/articles/PMC129937/pdf/0938.pdf
Membrane Topology of the Melibiose Carrierof Escherichia coli* by Martyn C. Botfield at https://www.jbc.org/article/S0021-9258(18)46019-X/pdf
Glycosylation of viral proteins: Implication in virus–host interaction and virulence.
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9037552/pdf/KVIR_13_2060464.pdf
Incredible detail, well done
I will be studying sugars more closely, looks like we have a shortage of sugar in Alberta Canada, not at all suspicious or concerning
Only noticing more and more young people getting eyeglasses and the connection to jabbed people having sugar distribution which is directly connected to the vision and brain center functioning - wonder how confounding the increased use of screens is for vision capacity long term.
https://expose-news.com/2023/12/04/the-doctor-that-sacrificed-his-career-his-reputation-and-ultimately-his-life/
NEW - Expose article on Dr. Moulden
December 4, 2023
The Doctor That Sacrificed His Career, His Reputation and Ultimately His Life.