Sars-Cov-2 Spike bioinformatics. Part 2.
How to get from one piece to much larger, while being a reductionist, copying human body parts and making synthetic, patentable drugs out of those little fragments, which become larger with time? Here comes an example. It starts with a very interesting article titled “COVID-19 Coronavirus spike protein analysis for synthetic vaccines, a peptidomimetic antagonist, and therapeutic drugs, and analysis of a proposed achilles’ heel conserved region to minimize probability of escape mutations and drug resistance" by B.Robson from Apr 2020. The article is about a piece of covid19 Spike protein (encoded in all genetically modifying ‘vaccines’ recipients) from the S2 domain, the essential cleavage point: KRSFIEDLLFN. Lets start to search for that fragment among all PATENTED proteins while using BLAST on NIH pages at: https://blast.ncbi.nlm.nih.gov/Blast.cgi
The first 100% match is for a “Receptor binding polypeptides” Patent: US 7491397-A 196 17-FEB-2009; National Health Research Institutes; Miaoli County;TW. The patented sequence, just in small letters : krsfiedllf nkvtl. Please note that the 2020 spike has ALSO identical ‘kvtl’ at the end!
The second match is for “SARS vaccine compositions and methods of making and using them” a Patent: US 8506968-B2 149 13-AUG-2013 by Eli Lilly and Company; Indianapolis, IN. Their sequence according to NIH BLAST output is: ‘plkptkrsfi edllfnkv’. The 2020 Spike sequence has the same ‘kv’ at the end and the begin is different only by 2 residues, instead PLKPT there is PSKPS.
The third match is for “Ii-key/antigenic epitope hybrid peptide vaccines” a Patent: US 8815249-B2 1149 26-AUG-2014; Antigen Express, Inc.; Worcester, MA. The sequence of this one is longer than EliLily’s, ’sqilpdplkptkrsfiedllfnkvtladagfm’ but even here almost 100% alignment with Spike 2020:
SQILPDPSKPSKRSFIEDLLFNKVTLADAGFI Spike 2020
SQILPDP-KP-KRSFIEDLLFNKVTLADAGF IDENTICAL with 2014 patent
sqilpdplkptkrsfiedllfnkvtladagfm ANTI-genic epitope
The 4th match of course is for the entire covid19 ‘vaccine’ titled: “Stabilized coronavirus spike (S) protein immunogens and related vaccines” Patent: US 10906944-B2 39 02-FEB-2021; The Scripps Research Institute; La Jolla, CA.
The 5th match is for “Baculovirus and composition for detection and preventing of porcine epidemic diarrhea virus infection“ Patent: US 11123424-B2 5 21-SEP-2021; ACADEMIA SINICA; Taipei.
This above patented porcine epidemic vaccine sequence is almost identical with the 2018 patented “Vaccines for porcine epidemic diarrhea virus infections” Patent: US 10143739-B2 3 04-DEC-2018; by KANSAS STATE UNIVERSITY RESEARCH FOUNDATION; Manhattan, KS“
And now comes the point, that above 2018 porcine vaccine (NIH code AZL36959.1) has 95% sequence coverage with ~30% IDENTITIES with the score of ~300 for the S2 domain of the 2020 corona Spike protein!
The 2 next hits are for almost identical covid vaccines, one for
“Coronavirus proteins and antigens” Patent: US 10280199-B2 15 07-MAY-2019 Phibro Animal Health Corporation; Teaneck, NJ
and the second for “Prefusion coronavirus spike proteins and their use” Patent: US 10960070-B2 38 30-MAR-2021; BY The United States of America, as represented by the Secretary, Department of Health and Human Services, The Scripps Research Institute and Trustees of Dartmouth College; Bethesda, MD; US; the NIH code for it is QXC81556.1.
If you take the 2018 porcine vaccine (AZL36959.1) and now compare with what HHS+Scripps+Md college patented in 2021 for coronavirus spike (filed in 2016 actually ), QXC81556.1, you get 100% sequence coverage with 99.5% identities!!! OK, but that’s only for: MERS-CoV, SARS-CoV, NL63-CoV, 229E-CoV, OC43-CoV, HKU1-CoV, WIV1-CoV, MHV, HKU9-CoV, PEDV-CoV, or SDCV.
Well BLAST gives the above ~30% of identities of that swine spike in comparison to the 2020 Spike, BUT if you look by eye (with glasses) you will notice the entire C-terminal section:
ETYIKWPWWVWLIIFIVLIFVVSLLVFCCISTGCCGCCGCCCACFSGCCRGPRLQPYEVFEKVHVQ in swine flu
EQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT in 2020 SARS-CoV-2 Spike
looks really similar, BUT BLAST ‘just can’t get it’ in order to include it in the score… Isn’t it similar to some of the covid statistics issues, which ‘just’ won’t see the truth?
Btw. isn’t diarrhea popular these days? Sorry, morere questions, than answer’s.