MAGNETO2.0, SARS-CoV-2 Spike gene therapy injections, the magnetized human bodies and beyond.

Update 11/10/2022: Everyone knows the links to the official Pfizer covid injections containing basically 4 different types of chemicals, synthetic genetic material mod mRNA ( very negatively charged due to large amount of phopho-groups) salts (all charged entities), nano-lipids (positively charged in order to keep the oppositely charged synthetic genetic material protected) and cholesterol. NONE of these compounds contain MAGNETIC substances and yet you can read in official documents listing the side effects of the injections: https://phmpt.org/wp-content/uploads/2022/04/reissue_5.3.6-postmarketing-experience.pdf :

-Magnetic resonance imaging liver abnormal; -Magnetic resonance proton density fat fraction measurement;

The amount of FATS in Pfizer injection material is :lipids (0.43 mg (4-hydroxybutyl)azanediyl)bis(hexane-6,1-diyl)bis(2-hexyldecanoate), 0.05 mg 2[(polyethylene glycol)-2000]-N,N-ditetradecylacetamide, 0.09 mg 1,2-distearoyl-sn-glycero-3- phosphocholine, and 0.2 mg cholesterol)= 0.77mg of total FATS. There is NO method out there to resolve that small amount of fats, and yet, how comes that 0.77mg of synthetic fats can affect the measurement based on magnetic effects?

Urgent update 4/15/2022: blood changes seen recently in the population by Philippe van Welbergen D.Hom.Med MSc DHPh CLS​ MASLMS MHMA(UK) :

https://dailyexpose.uk/2022/04/14/graphene-tranmitted-vaccinated-to-unvaccinated-blood-clots/

these horrifying blood changes are directly related to the presence of magnetized rGO (n-doped) reduced graphene oxide in the covid injections. Graphene does absorb high frequency radiation in Ghz range. The previous post had more information about it:

SARS-CoV-2 Spike protein, 5G and covid19

6/7/2022- Graphene oxid explanation of all ‘covid’ issues by Biostatistician Ricardo Delgado Martin, in German: https://uncutnews.ch/was-graphenoxid-und-nanotechnologie-in-covid-impfstoffen-mit-5g-zu-tun-haben-interview-mit-biostatistiker-ricardo-delgado-martin/

Graphene, the cheapest weapon of all.

=========================================================================

It is almost one year since Brighteon, bitchute, many online news channels reported thousands of cases of magnetization of specific body parts, like the injection site, hands, head, chest, after receiving the covid19 injections. ICAN (Del Bigtree on Highwire) performed their own investigation and confirmed the fact on multiple random citizens. Some authors analyzed that issue more in depth, like: https://thefreedomarticles.com/amp/does-magnetic-hydrogel-explain-covid-vax-magnet-phenomenon/

The entire story was finally forgotten, because not every covid injection contains the same material (batch differences), thus not everyone was affected, also possible lack of interest over time. But if true (one can’t accept anything until one can see it with own eyes), it is unprecedented, the human body was never before magnetized to a such high level, thus this should have been enough to start an investigation, and yet, not a single official agency touched that topic, except for the fact checkers claiming the issue does not exist. How similar to the fact, that people are not aware of undergoing a gene therapy while taking the covid shot. Equally similar to the fact of damages caused by oxygen deprivation and CO2 saturation with every breath while wearing a mask. In case of emergency, people accept everything, because the ‘officials’ tell them the ‘fact checked stories’, usually exactly the opposite ti the truth.

The utter ignorance of the human body, by the human beings, which started in the viral year of 2020, on a massive scale, is heartbreaking. Only few scientists were aware of what was going on, Dr. Judy Mikovits being one of them. She appeared on Mikki Willis truly eyes opening movies Plandemic and Plandemic II:

https://plandemicseries.com/

https://www.brighteon.com/d240160e-ee78-4647-a9bb-9394705a1528

In Apr 3rd '22 interview with Dr.'s R.O. Young, C. Madej and Ramola D.

https://www.drrobertyoung.com/post/carnicom-disclosure-project-dr-madej-dr-mikovits-dr-young-ramola-d-attack-on-human-health

while discussing the magnetic properties seen in many covid injected individuals, Dr. Mikovits mentioned a completely synthetic protein called MAGNETO, as a possible explanation for the massive magnetization. That huge synthetic monster is a hybrid between only 2 subunits of a human iron storage protein ferritin (similar to the rat homolog), which normally has 24 subunits building a cage storing ~4500 ferric atoms, https://www.rcsb.org/structure/2FG4. The second part of MAGNETO is a mechano- and thermosensitive calcium channel protein TrpV4 from the rat. The genetic cocktail was produced while using s.c. promoters both of human and viral origin, inside of the same cell line used for vaccines production, the human embryonic kidney HEK293 cells. The TrpV4 protein ( https://www.uniprot.org/uniprot/Q9HBA0 ) naturally participates in 45 different biological processes while performing its 18 molecular HUMAN functions. For its mechanical features it uses energy molecule ATP and the positively charged metal ion Ca+2. The MAGNETO, according to the abstract of the study^1:" is capable of remotely controlling circuits associated with complex animal behaviors." The remote control was done via application of static magnetic fields on the victimized animals, which suddenly induced neuronal action potentials, only in the presence of the strong enough magnetic field (produced by N52 bought on ebay..).

To assure the money flow for this research, the authors promise: “Continued optimization and utilization of this magnetogenetic actuator will position the field to better understand neural development, function, and pathology." The GENETIC MUTILATION of the animals was signed of by: University of Virginia Institutional Animal Care and Use Committee (IACUC)!! And the most important of all, who paid for this work?: "This work was supported by 5T32GM008328, 5T32GM008136, a Neuroscience Center of Excellence fellowship, and a Wagner Fellowship (MAW); F32NS087791 (CJS); NIH – NINDS R01NS072212 (SK), etc.. The genetic sequence of MAGNETO2.0 (improved version) was deposited in ADDgene library. The MAGNETI2.0 sequence of ~2100 amino acids appears to have 30% identities with the injected SARS-CoV-2 Spike amino acid sequence, including the homologies of the biding sites for the iron. Here some of the amino acid sequences homolog between the MAGNETO2.0 and Spike with Query being Spike and Sbjct line representing MAGNETO2.0 amino acids:

Query  1191  KNLNESLIDLQELG  1204    SARS-CoV2 Spike 
             K LN++L+DL+ LG
Sbjct  1114  KKLNQALLDLHALG  1127    MAGNETO2.0
Query  1162  PDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQEL  1203
             PD D  + SG+NA    ++ E        KN N+SL++L+ L
Sbjct  1296  PDCDDWE-SGLNAMECALHLE--------KNVNQSLLELHKL  1328
Query  174  PFLMDLEGKQGNFKNLREFV---FKNIDGYFK  202
            P L+D+  + G   N+REF+   F++I  Y++
Sbjct  438  PVLLDIAERTG---NMREFINSPFRDI--YYR  464
Query  215   DLPQGFSALEPLVDLPIGINITRFQTLLALHR  246
             D   G  A+E    L   +N    Q+LL LH+
Sbjct  1300  DWESGLNAMECALHLEKNVN----QSLLELHK  1327
Query  681  PRRARSVASQ  690 <<< Spike furin site
            P   R+VASQ
Sbjct  109  PATLRAVASQ  118
Query  987   VEAEVQIDRLITGRLQSLQTYVT  1009
             VEA V  + L+   LQ+  TY +
Sbjct  1022  VEAAV--NSLVNLYLQASYTYLS  1042
Query  680   SPRRARSVASQ-SIIAYTMSLGAENSVAYSNN-SIAIPTNFTISVTTEI  726          <furin site
             S RRA S  +Q S     + + A   VA     S+ I + F I   + I
Sbjct  1439  SARRANS--TQLSCTKLALKIIAHQFVATNRSLSVKIKSLFAIQLISPI  1485
Query  675   QTQTNSPRRAR  685  <<again SPike furin site
             QT    P+R++
Sbjct  1903  QT----PKRSK  1909

One can get similar homologies when comparing Spike with human ferritin directly. Even comparison of Spike with the largest known to date protein titin with ~34 000 residues, which gives similar statistics to the Spike-MAGNETO2.0 comparison, does not show that amount of clustering of the similar or identical pieces.

The fact that MAGNETO2.0 is so sensitive to magnetic fields is not easy to explain with just the 2 copies of ferritin units, instead of necessary 24 (which even then are hardly measurable), the cited publication doesn’t even give a try to do it. The ionotropic cannabinoid receptor TrpV4, one of the 6 of the family members mediating many neural signaling processes implicated in the sensation of temperature, pressure, and pH, as well as smell, taste, vision, and pain perception, might have to do something with their results.. In particular the TrpV2, the Transient receptor potential cation channel subfamily V member 2, which is regulated in part by IGF-I, PDGF and neuropeptide head activator (Morphogenetic neuropeptide first isolated from nerve cells of hydra) could maybe give a hint as to why Dr. Madej observed the strange growing features in some of the injection vials.

But already knowing that ~30% of amino acids used for Spike production, instead for all TrPV family members, one can imagine now why frequently there is the loss of smell and taste, in everyone affected by the Spike, whether from the genetic injections or via shedding by those who got it.

Having the right biological building blocks is essential for a regeneration in every moment of our lives. Thus equally concerning is the fact, that huge amount of pieces of small neuropeptides listed at: http://proteomics.ucsd.edu/Software/NeuroPedia/Downloads/Neuropeptides_human.fasta

can be found within the Spike sequence. And be it as small as a single dipeptide within for example, gonadoliberin-2 (QHWSHGWYPG) or neurotensin ( QLYENKPRRPYIL, do you recognize part of the furin site here?) or bradykinin (RPPGFSPFR) or angiotensin-3 (RVYIHPF) or the Low molecular weight growth-promoting factor|Kininogen-1 (WGHE) or the Leu-enkephalin (YGGFL) or the gastrin-6 (YGWMDF) or the simple neuropeptide gamma (DA, three of those in Spike!!!) or lastly the urotensin-2B (ACFWKYCV) somewhat similar to the Fauci’s patented HIV drug, his little ‘CWLDVC’ peptide with the general sequence CxxxxC!

Oh, and how many of ‘CxxxxC’ sequence homologs are inside of the universal toxic spike, injected into billions? ‘CEFQFC’, ‘CCMTSCC’ (two intertwinned), ‘CLKGCC’, ‘CCSCGSCC’!!! One has to remember, cysteine (Cys=C) residues are responsible for a 3D fold of all proteins, they participate in our look, in the shape of the entire nature!

Fauci’s patent belongs to s.c. cyclic small peptides where the cysteine at both ends are building a chemical bond, a Cys-Cys bridge making a loop. An example of those is CRGDWPC which belongs to VENOME peptides, a drug called Eptifibatide from Sistrurus miliarius, targeting the integrin protein family. According to PubChem: “eptifibatide is an anti-coagulant that inhibits platelet aggregation by selectively blocking the platelet glycoprotein IIb/IIIa receptor, so preventing the binding of fibrinogen, von Willebrand factor, and other adhesive ligands.“ And that feature comes from that unique ‘RGD’ motif described in

Dr. Bret Weinstein, Yuri Deigin and 'RGD' motif in SARS-CoV-2 Spike protein, essential in SYNTHETIC biology

and also in ^4 and many other resources. Here another hand alignment of one more venome peptide with the injected Spike sequence (after seeing Bryan Ardis venome shows):

        DTHFPI-C-IFCC----GCCHRSKCGMCCKT  Hepcidin=DRUG
         T   + C   CC    GCC  S CG CCK        
  LIAIVMVT-IMLCCMTSCCSCLKGCC--S-CGSCCKF  Spike

Dr. Bryan Ardis featured at Stew Peters today pointed to a very interesting and important idea, possible presence of snake toxins embedded in the spike sequence. Well the paper^2 he talked about, has exactly that, what we are looking here: a motif of ‘CxxCxxxxCxxxxxCxxxxxxC’ from snake’s family toxins and the C-terminal portion of the SARS-CoV-2 Spike protein which was the thorn in my eye for the last ~2.5 YEARS!!!: CCMTSCCSCLKGCCSCGSCC. That Cystein cluster sequence was conserved and patented already for a very long time, from the begin of corona viruses, and now the cysteines motif fits to a simple tiny snake Neurotoxin Nk-3FTx, here the overlap, BY HAND:

CCMTSCCSCLKGCCSCGSCCKFDEDDSEPVKGVKLHYT SARS-CoV2 seq CCXXXCCXCXXXCCXCXXCC with the C representing small x one can get: CxXXXCCXxXXXCxXxXXxC «= scheme of SARS-CoV-2 Spike

LTCLNCPEMFCGKFQICRNGEKICFKKLHQRRP Snake Nk-3FTx neurotoxin

2 4 5 6

CXXCXXXXCXXXXXCXXXXXXC «= scheme of snake neurotoxin C0HJW9

What a coincidence! One has to remind though, this is a very tiny portion of the SPike sequence (~1300 residues). The above C0HJW9 snake three-finger toxin family has only 33 amino acids, that’s ~2.5% of the entire Spike sequence, which has way more functions embedded than ‘just’ that cysteine-rich cluster. Updated talk by Bryan can be found at: https://rumble.com/v10myhi-4.11.22-patriot-streetfighter-interview-w-dr.-bryan-ardis-exposing-the-serp.html

contains way more scientific references related to the suggested ‘venom’ origin of covid19. I can just add that not only the C-term has the Cys-rich ‘snake toxin signature’, there is another published study^3, conforming the same with the Spike ACE2 receptor domain containing another Neurotoxin homolog NL1 (Q9DEQ3):

The above figure from the cited paper didn’t even list quite few other sections equally homologous between the Spike and the venom neurotoxin which are there when runnning BLAST with custom defined parameters (in query line we have the neurotoxin, in Subjct the Spike):

Query  10   VVTMVC  15   neurotoxin Q9DEQ3
            VV  VC
Sbjct  126  VVIKVC  131  Spike
Query  73   GKYVYCCR--RDKCN  85
            G Y Y  R  R K N
Sbjct  447  GNYNYLYRLFR-KSN  460
Query  61   GC--TFTCPEL--RPTGKYVYCCR  80
            GC        L     G Y Y  R
Sbjct  431  GCVIAWNSNNLDSKVGGNYNYLYR  454
Query  53   GNDVR-IKRGCTFTCPELRPTGKYVY  77
            G++VR I  G T    +      Y Y
Sbjct  404  GDEVRQIAPGQTGKIAD------YNY  423
Query  72   TGK---YVY  77
            TGK   Y Y
Sbjct  415  TGKIADYNY  423

The presence of the cysteins (C, sulfur containig amino acid), tyrosines(Y) and charged residues, like Arg (R) or Lys(K), or even the simple glycine (G), being the inhibiting neurotransmitter, are all extremely important. What is even more important is that the section of the neurotoxin overlapping with the Spike, shown above is exactly the one overlapping with countless patents for example for:

-”Carbohydrate-based drug delivery polymers and conjugates thereof” from US 8680263-B2 218 25-MAR-2014

-”Short chain neurotoxin from sea snake-Lapemis hardwickii and genes encoding the neurotoxin” US 7294697-A 8 13-NOV-2007

-”Nutritive fragments, proteins and methods” US 9700071-B2 2430 11-JUL-2017

-”Postsynaptically targeted chemodenervation agents and their methods of use” US 9815875-B2 92 14-NOV-2017

-”Light-activated fusion proteins and uses therefor” US 9163094-B2 4 20-OCT-2015

From the above descriptions alone, one gets the idea for how many different purposes these synthetic proteins, derived from ONE NATURAL component, are being used for. Take in turn the last MIT+NIH+DARPA patent 9163094 and compare this 95 amino acid long fusion construct directly with the Spike sequence, almost 50% are identities again, for example:

Query  5     LLTLVVVTI  13 Light activated fusion protein
             L   V VTI
Sbjct  1224  LIAIVMVTI  1232  Spike
Query  75   YEEVTC  80
            Y++V C
Sbjct  612  YQDVNC  617
Query  82  STDKCN  87
           ST+K N
Sbjct  94  STEKSN  99
Query  10   VVTIVC  15
            VV  VC
Sbjct  126  VVIKVC  131
Query  20   YTI-VCHTTATSPIS  33
            +TI V  TT   P+S
Sbjct  718  FTISV--TTEILPVS  730
Query  79   TCC----ST----DKC  86
            T C    ST    +KC
Sbjct  523  TVCGPKKSTNLVKNKC  538
Query  20   YTIVCHTTATSPISAVTCPPGE--NLCYRKMWCDAF  53
            Y+++ ++ + S        P +  +LC+  ++ D+F
Sbjct  365  YSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF  400
Query  48    MWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHP  90
             M C   C +       GC  +C S        CC  D+ +  P
Sbjct  1233  MLC---CMTSCCSCLKGC-CSCGS--------CCKFDEDDSEP  1263

With the latter, one question arises, does Spike contain some segments which can be LIGHT activated, thus FREQUENCY DRIVEN??? In the above NIH+MIT+DARPA patent 9163094 ( https://patents.justia.com/patent/9163094 ) in the section “Polypeptide Ligand Domain“ there is an example paragraph referencing a homolog to the MAGNETO2.0 portion, quote:

“Examples of polypeptide ligands for Transient Receptor Potential (Trp) channels that may be included in a fusion protein of the invention include, but are not limited to a VaTx1 sequence, a non-limiting example of which is a Psalmopoeus cambridgei VaTx1 polypeptide comprising the amino acid sequence set forth as SECRWFMGGCDSTLDCCKHLSCKMGLYYCAWDGTF (SEQ ID NO:7), or a derivative thereof; a VaTx3 sequence, a non-limiting example of which is a Psalmopoeus cambridgei VaTx3 polypeptide comprising the amino acid sequence set forth as ECRWYLGGCKEDSECCEHLQCHSYWEWCLWDGSF (SEQ ID NO:8), or a derivative thereof. “ Here a hand alignment of the above SEQ NO 8 with the Spike:

ECRWYLGGCKEDS-ECC--EHLQCHSY--WEWCLWDGSF	 PATENDED ABOVE 
  +  L     +  E    E  Q   Y  W W +W G F
VAKN-LNESLIDLQELGKYE--Q---YIKWPWYIWLG-FIAGL	 SPIKE

Almost all the 280nm absorbing amino acids Trp(W), Tyr(Y), Phe(F), including lot of the charged residues are conserved. The light-oxygen-voltage (LOV) domain is yet another part of the patented fusion protein for ‘engineering LOV-based photoswitches’, basics of optogenetics..

Understanding this patent will help in understanding the Spike pieces and their goal. That’s a work for tomorrow…

And last but not least to the ‘venom’ theory of covid19, the autopsies results, the embalmers stories, should tell the rest… With the onslaught of genetic modifications on humanity, one has to be really very cautious when seeing publications like this one:

“Generation of antibodies against disintegrin and cysteine-rich domains by DNA immunization: An approach to neutralize snake venom-induced haemorrhage“ which would imply, first the pieces of the disintegrins are being embedded into the human genome via covid injections, and then more new modifications, to apparently reduce the effects of the previous ones. The play field for the pharma cartel became INFINITE with the number of genes, peptides, encoding the entire nature inter-twinned with never ending chemicals, each one of which is building an anti-body in every human body. The next onslaught on the horizon is the genetically modified OXITEC mosquitos..

The availability of every single amino acid in our bodies decides about processes described alone in titles of many articles, for example:

1. Amino Acid Metabolism in Cancer Drug Resistance - PMC

   ncbi.nlm.nih.gov/pmc/articles/PMC8750102

   “In this review, we introduce the amino acid-driven drug resistance mechanism in tumors and highlight amino acid-dependent vulnerabilities in cancer cells that can be leveraged to improve anticancer drug therapies. We also discuss the specific roles of amino acids—in particular, immune responses to anticancer immunotherapies.”

2. Regulation of Intestinal Epithelial Cells Properties and Functions by Amino Acids. ncbi.nlm.nih.gov/pmc/articles/PMC5966675

   “2.2. Amino Acids Regulate the Proliferation and Differentiation of IECs. The maintenance and growth of intestine is driven by the amount of luminal nutrients. High nutrient content causes increases in the cell number, villus length, and crypt depth [13, 19, 20].

   We also summarized some important findings on the effects of amino acids supplementation (e.g., glutamine and arginine) in restoring IECs' and intestine functions in some diseased states. These findings will further our understanding of the important roles of amino acids in the homeostasis of IECs and could potentially help identify novel targets and reagents for the therapeutic interventions of diseases associated with dysfunctional IECs.“

3. “Effect of Oxygen Tension on the Amino Acid Utilisation of Human Embryonic Stem Cells”

   researchgate.net/publication/260093917_Effect_of_Oxygen_Tension_on_the...

   ”These data suggest that amino acid turnover could be used as a measure of the self-renewal capacity of hESCs.”

4. Translational Control through Differential Ribosome Pausing during Amino Acid Limitation in Mammalian Cells

   cell.com/molecular-cell/fulltext/S1097-2765(18)30516-1

5. “Influence of Amino Acid Metabolism on Embryonic Stem Cell Function and Differentiation” https://academic.oup.com/advances/article/7/4/780S/4568680

   Epigenetic mechanisms are recognized as critical steps in differentiation, and AA metabolism in ESCs appears to modulate these epigenetic processes.

6. “Inhibition of Amino Acid Metabolism Selectively Targets Human Leukemia” Stem Cells“ https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6280965

   Pharmacological inhibition of amino acid metabolism reduces oxidative phosphorylation and induces cell death.

7. “Amino acids in cancer”

   https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7000687/

   Amino acids, nutrients vital to the survival of all cell types, experience reprogrammed metabolism in cancer. This review outlines the diverse roles of amino acids within the tumor and in the tumor microenvironment.

   Beyond their role in biosynthesis, they serve as energy sources and help maintain redox balance. In addition, amino acid derivatives contribute to epigenetic regulation and immune responses linked to tumorigenesis and metastasis. Furthermore, in discussing the transporters and transaminases that

   mediate amino acid uptake and synthesis, we identify potential metabolic liabilities as targets for therapeutic intervention.

Summarizing: a synthetic genetically driven Spike production in human bodies induced by the covid19 injection materials, is the tip of scientific crime, fraud and evil, if not blatant stupidity and arrogance. And that, based alone on the officially available SARS-CoV2 Spike sequence from NIH genome libraries: https://www.ncbi.nlm.nih.gov/nuccore/NC_045512.2 not even touching the topic of nano-materials, synthetic chemicals, or who knows what else is being injected into all the victims.

There is only one need in this world: STOP INJECTING HUMAN BODIES WITH the genetically reprogramming synthetic toxic covid19 concoctions, killing and injuring millions. STAND UP FOR YOUR GOD GIVEN HUMAN RIGHTS!

Would like to close with one question and hopefully a permission to show this one picture from the ‘Nature Materials’ 2015 article titled ‘A magnetic protein biocompass’: within a moving body oriented most frequently in upward direction, one would assume a pre-orientation of the inner magnets in regard to the external magnetic field, and now, how all the animals bodies actually work that this pre-orientation needs to vary in every spot of the varying direction and strength of the magnetic field of our round earth??? Let’s hope NIH will find some money to pay for this study too. Oh, and hopefully these won’t be magnets purchased from ebay, but from some small business owner knocked down by the covid catastrophy. And that we never learn enough about our space around us, which so many important people say, ‘has no up or downs’:

https://www.bitchute.com/video/v2B35uUU3fGU/

that one still can’t answer the simple question, why do we walk with our feet touching the earth, while our heads are way up… How about aligned dipoles put intelligently everywhere around, inside and throughout everything generating a field connected to the origin of it all?

There is an interesting video touching many historical and factual issues related to the magnetism and human brain: https://www.brighteon.com/19cfce21-e0b1-4eaf-9b43-bd53766ed1d1

The above can culminate in one of the most discussed issues of our times, extensively researched by some for quite a long by now:

https://www.brighteon.com/0c8a5913-93ca-4ffa-ad64-1e467011ab58

References.

1. Michael A. Wheeler et al. “Genetically targeted magnetic control of the nervous system” Nature Neurosci. 2016 May ; 19(5): 756–761. doi:10.1038/nn.4265.

2. Kushal Suryamohan et al. “The Indian cobra reference genome and transcriptome enables comprehensive identification of venom toxins” Nature Genetics, VOL 52, JANUARY 2020, p. 106–11.

3. K. Farsalinos et al. “Nicotinic Cholinergic System and COVID-19: In Silico Identification of an Interaction between SARS-CoV-2 and Nicotinic Receptors with Potential Therapeutic Targeting Implications“. Int J Mol Sci. 2020 Aug; 21(16): 5807.

4. https://pubmed.ncbi.nlm.nih.gov/1484742/ J A Williams “Disintegrins: RGD-containing proteins which inhibit cell/matrix interactions (adhesion) and cell/cell interactions (aggregation) via the integrin receptors”. Pathol. Biol. (Paris) 1992 Oct;40(8):813-21.