Insulin sequences within the universally injected Spike? Clock gene, Ozempic, cancer, wars and the last call of the lost Bifidos: STOP ALL RNA-based products, NOW.
This will be a very long post, won’t fit in an email, so please read it on substack directly. THANK YOU and MERRY CHRISTMAS;)) Christmas is about one Special Child and consequently about all Children, this post is about Children and their future, or lack of, despite of the title, on top of what is going on behind the scene already: https://rumble.com/v62er3n-save-the-babies-a-documentary-on-cps-child-trafficking.html
Update 3/9/2025: IMPORTANT findings from Sayers Ji, it is in regard to methylene Blue, a substance being used for mitochondrial dysfunction. Dr. Levy’s protocol for Spike detox has it on its list where it is well justified: https://www.tomlevymd.com/articles/omns20230204/Resolving-Colds-to-Advanced-COVID-with-Methylene-Blue, but for your own information here is also a link to Sayer’s post:
Update 2/6/2025: Sorry readers, if you are still there, this update is about indirect health, of those Palestinians, who are about to become HOMELESS, it is BAD, related somewhat to the first video here:
and if that was not enough, add to this that: https://caitlinjohnstone.com.au/2025/02/05/only-3-of-jewish-israelis-think-trumps-ethnic-cleansing-plan-for-gaza-is-immoral/
Update 2/3/2025: Sport events in the era of ‘post covid injections’: https://old.bitchute.com/video/MQHQMbtnjR8A/ => anger, agressivity, hate.
Update 1/26/2025: Protein Glycation discussed in this post is also responsible for the dark spots on the skin^1,^2,^3,^4,^5,^6 . Dr. Steven Gundry is known for treating it quite well with natural polyphenols.
Update 1/16/2025: Moderna announces in Apr ‘24: https://investors.modernatx.com/news/news-details/2024/Moderna-and-OpenAI-Collaborate-To-Advance-mRNA-Medicine/default.aspx , with broad adoption of ChatGPT Enterprise. Well OpenAI is connected with not only massive corruption, but now also with a COLD BLOODY murder of Suchir Balaji!!! The deepest crimes are merging.
Update 1/2/2025: BLESSED HAPPY, HEALTHY NEW YEAR to everyone!!!) Post unrelated: Salary of PhD working on H1B visa for NIH in 1997 was ~1600$/month, i.e. ~19,000/year, while in the same time average federal worker income was ~38,000$/year according to https://babel.hathitrust.org/cgi/pt?id=uiug.30112075337979&seq=436 Yes, foreign workers are the modern SLAVES in this money governed world!
Update 12/28/2024: a must interview about new hit on RFK Jr.: https://tuckercarlson.com/tucker-show-aaron-siri and the newest 2025 ‘indirect’ hit: https://tuckercarlson.com/tucker-show-bernard-hudson
Update 12/27/2024: few informative videos were added in text, one by Dr.Eric Berg revealing how to restore your weight/muscle mass and more, with home made yogurt using L. Reuteri.
Update 12/29/2024: pubmed search at https://www.ncbi.nlm.nih.gov/pmc/?term=EDTA+and+antibiotic points to many publications about restoring antibiotic sensitivity and many more health issues related to heavy metals poisoning.
Update 12/30/2024: For everyone who needs pharmacies, A MUST interview: https://tuckercarlson.com/tucker-show-brigham-buhler
After the worldwide illegal application of Fauci’s+ NIH+Co. universal SAS-CoV-2 Spike gene therapy, finally attention is being paid to never seen before cancers, with ‘new biology‘ (https://old.bitchute.com/video/CNzDYGgP4r5F/). Most recent confirmation of incorporation of the foreign DNA contamination into the human genome is now out: https://dailysceptic.org/2024/11/25/dna-contamination-of-mrna-vaccines-can-integrate-into-human-dna-top-molecular-scientist-confirms/. Similar to the influence of a foreign transplanted organ into a patient, here we got some examples of changes in human behavior caused by the covid gene therapies: https://old.bitchute.com/video/XZIuKIiGdGrI/. But that’s not the only ‘new normal’, there are skyrocketing deaths tolls among all age groups, newborn included, all professions, teachers, pilots, soldiers, young students, elderly, all are affected. It’s absurd to pick that out, but increasingly disturbing death rates among many populations somehow mirror the completely different arena, armed conflicts, shown below. Since the diagram ends in 2022 it does not include deaths in Ukraine in the last 2 years and the ~44.000 killed in Gaza with less than half of it completely innocent children (first part www.youtube.com/watch? then add v=gEo813rYm8g) :
and one more horror story at: https://tiktokgenocide.com/uploads/6-yo-child-displaced-legless. It seems link the hidden crimes never end, 2 examples of which are discussed at: https://www.brighteon.com/be048ad3-8170-4e50-8385-236e3037f14f , and here:
And how many children, in US alone, died after the so ‘safe and effective’ covid19 genetically modifying injections? Other news like ABC says this: “Nearly 120,000 children in US have lost a primary caregiver to COVID-19: Internal CDC data”. Were the parents possibly equally covid injected?
Is it all a coincidence that the increasing death trends are reaching peaks everywhere, as if the insanity by the partially lost 1p36 gene is really happening? The first BNT-162B2 ‘side effect’ admitted by Pfizer on its list with >1000 side effects, is the 1p36 gene deletion, characterized by an intellectual disability, behavioral problems, etc. Question, do vaccines delete entire genes? NO, TARGETED GENE THERAPIES DO. Therapies with foreign synthetic genetic material, equipped with the good old biology mimicking properties, a lab made patented concoctions, all subject of the most ‘modern science’, paid by the richest in the world and supported by Nobel prize winners who now have the guts to stand in the way of Trump’s HHS nomination. The same tactics of Nobel prize winners happened in the past with the introduction of genetically modifying plants and a trial of hindrance of the proper labeling of the synthetic GMO food, now leading to an explosion of chronic diseases across the globe.. If you are not interested in news connecting politics and science, please jump to the first divider bar below for analysis touching Spike science related to diabetes;)
First a warning about our current situation from Dr. David Martin: https://rumble.com/v6091q8-dr-david-martin-bioweapons.html (VERY IMPORTANT).
At least in terms of real health science in US there is a hope with this one nomination of RF Kennedy Jr as HHS secretary. Already anti-movements to MAHA are out there, with some of its faces at: https://committeetoprotect.org/about/, https://ctpedfund.org/board-members/ , https://www.eenews.net/articles/health-care-organization-launches-stop-rfk-war-room/ , https://www.wfyi.org/news/articles/former-vp-mike-pence-wants-senate-republicans-to-reject-rfk-jr--trumps-pick-for-hhs and the most involved into ‘arrangements’ of the mod mRNA shots production Scott Gottlieb says he’s against RFK Jr. for HHS: ‘It will cost lives in this country’”. Gottlieb together with Mark McClellan (Johnson&Johnson, https://healthpolicy.duke.edu/people/mark-mcclellan-md-phd), running also the Global Alliance for Genomics and Health https://www.ga4gh.org/our-community/organisational-members/#{“organisation”:{“page”:”21”}} (toggle the last numbers between 1 and 51, to see for example google, Intel, BMGF, LabCorp producing right now the H5N1 tests, this time…) both were very active during covid.
The just assassinated Russian general Igor Kirillov, No 1 specialist on nuclear, bio and chemical weapons, had Gottlieb(Pfizer/FDA) and McClellan plus Steven Hahn from the Flagship Pioneering Inc.(Mod-E-RNA) on his list of the criminals involved in production and the biggest money making scam around the most dangerous covid 'vaccines' in connection with Ukraine biolabs (https://rumble.com/v60xgnw-scott-ritter-moscow-assassination-ignites-russian-retaliation-ukraine-hidde.html). Dr. Andrew Huff was talking and writing so much about it (https://rumble.com/v28ex34-dr.-andrew-huff-on-ecohealth-metabiota-the-cia-and-the-biden-connection.html).
On 12/12/2024, a new RFK front opposition was assembled: 77 Nobel prize winners.. One of them is Dr. Drew Weissman, who with Dr. Kariko won the 2023 Nobel Prize for the mod mRNA invention, applied in majority of all covid19 genetically modifying injections (Pfizer, Moderna). Dr. Kariko didn’t sign the opposition letter though, why? And then Dr. Baltimore ( interaction between tumor viruses and the genetic material of the cell) did, and so did Joseph L. Goldstein ( regulation of cholesterol metabolism) and Harold E. Varmus (cellular origin of retroviral oncogenes), and Stanley B. Prusiner ( discovery of prions – a new biological principle of infection) signed too, but then Michael Levitt (multiscale models for complex chemical systems) this time didn’t, just wonder why? Many of those are the same people who signed on a support of the precision agriculture using GMO’s (https://www.supportprecisionagriculture.org/view-signatures_rjr.html) to genetically change the human food supply! All these top scientists know exactly what mRNA does, they did the first science on it, and now they allow others to drive a crime beyond human imagination, only in order to cover up for revelations like this: https://x.com/Donuncutschweiz/status/1871556592187150536
Fight for the truth is not easy, very important reminder of 2019 story. RFK’s health related Samoa visit in June 2019 was strangely followed by measles ‘incubation’ exactly the next month after, measles epidemic in Oct/Nov/Dec ‘19, with by 20th Dec 94% population vaccinated in a ‘Mandatory door-to-door vaccination trial..’ MSM is blaming RFK Jr for the deaths not mentioning that it was the vaccinated, who were dying. 1g of Vit C, every 2 hours, and up to 100,000 IU of Vit A for 3 days was the solution to the tragedy according to a local hero, Kennedy’s collaborator Edwin Tamasese who started that protocol, and was later on arrested and sued for that(!). Luckily all charges were dismissed, obviously due to fraudulent accusations. The only truthful report on the details of what happened one can find at: https://childrenshealthdefense.org/defender/lsamoa-medical-freedom-hero-court-case-dismissed/ written by RF Kennedy Jr. himself. It is not known, but possible, that a test of Baric’s measles-covid19 vaccine combo was performed down there already in 2019 while using inactivated measles virus carrying the synthetic “codon-optimized for Homo sapiens“ SARS-CoV-2 spike glycoprotein (https://www.ncbi.nlm.nih.gov/nuccore/MW090971.1) Arkmedic's blog post from 2022 at
indicates that it was also a test for human compliance, with the deaths statistics 1 in 67 and not 1/10,000 like it used to be in case of measles. Back to covid issue with the hope that all the other in the past so PRO-COVID individuals, in particular this controversial choice:
who are now appointed as ‘health’ candidates, will help to lead that, what Americans really wanted, real MAHA, which can be as simple as delivery of the basic vitamins A,B,C,D,E and necessary minerals, nutraceuticals with healthy fats and proteins, without synthetic patented genetic materials and infinity of toxic chemicals in our food, air and water… I can only shout the same: STOP the mod mRNA NOW, in any form, in any product, in particular, after finding out that scientists knew already in the 50-ies that bacterial Bifido species DO NOT GROW AND MULTIPLY in the presence of RNA building blocks (more on it below the second divider). Every OLD citation below, going back >70 years and answering todays’ questions in regard to covid shots side effects, kind of indicates a premeditated action by the medical and scientific community.
Another terrifying message by RFK’s team shown in a documentary titled ‘Authorized to kill’ (https://live.childrenshealthdefense.org/chd-tv/videos/vaxxed-3-or-authorized-to-kill-movie/ ) uncovers that the hospital’s covid protocols were killing ‘accidentally’ predominantly the covid unvaccinated, to propagate lies. Thus it is no wonder, many ‘covid installers’ are on the highest alert. And the irony goes way deeper than we even imagine, from TeamKennedy.com:”Dr. Anthony Fauci, now a private citizen, enjoys taxpayer-funded security costing more than $15 million since his retirement in January 2023 — complete with U.S. Marshals, a chauffeur-driven limousine, and armed protection. Meanwhile, Robert F. Kennedy Jr. was denied Secret Service protection for all but 43 days of his campaign. Even after multiple extremely alarming threats to his life, the Biden administration ignored the long-established practice of affording protection to high-profile candidates.” Other source reports on 12/5/2024: “Rumors of President Biden considering a blanket pardon for Dr. Anthony Fauci have sparked a wave of outrage and concern.” A pardon can be only issued for somebody who committed a crime, in this case, Anthony Fauci, the top U.S. public health official on infectious diseases, who won the 2021 Dan David Prize – one of the most prestigious Israeli academic awards. The pardon would not be for enriching himself and others (https://www.jewishledger.com/2020/11/the-jewish-connection-to-the-covid-vaccines/ , https://x.com/Donuncutschweiz/status/1864573924681621791), but rather for the deaths and injuries during the covid response and in particular for the deaths the genetically modifying injections caused and are causing, to this day.
The very first BNT-162B2 mentioned ‘side effect’, the 1p36 gene deletion (https://www.malacards.org/card/chromosome_1p36_deletion_syndrome) is worth few more thoughts. This ‘side effect’ like everything else in the human body, is related to main energy source, the glucose. 2014 article with the title “Type II diabetes and impaired glucose tolerance due to severe hyperinsulinism in patients with 1p36 deletion syndrome and a Prader-Willi-like phenotype“ points to obesity and impaired glucose metabolism with countless other pathologies resembling some of the ‘covid19’ symptoms. Pancreas is producing not only insulin but also the 2 most anti-inflammatory, anti-cancerous enzymes, trypsin and chemotrypsin, and it can do it only while having its own energy supply divided between those processes. Will that have an effect on the current diabetes/cancer outbreak? You tell me. There is no official routine genetic testing of the covid injected, only that most recent bombshell from Kevin at:
But actually hidden in plain sight, the work on it is being done, reported for example in this publication “Curation and reporting of pathogenic genome-wide copy-number variants in a prenatal cell-free DNA screen“ (https://www.gimjournal.org/action/showPdf?pii=S1098-3600(24)00157-6) with the conclusion: ”This framework for genome-wide fetal-CNV reporting carefully prioritizes findings with the potential to affect reproductive decision making” mentioning 1p36 as a ‘comon microdeletion’!! In fact, the entire biotechnology field with companies like Gingkoworks, which just ‘swallowd’ Metabiota, are working on human cell programming and ‘biosecurity’. Gingkoworks recent goal of mammalian cell engineering and induced pluripotent stem cell (iPSC) engineering is to create cells that produce and deliver therapeutic molecules—such as hormones, for ‘fighting diabetes’, among others. Their (BIO-INSYNC) project will utilize implantable bioelectronic devices in which engineered cells will produce therapeutic molecules on demand and/or measure disease biomarkers in real time. The ‘health care’ provider will monitor and CONTROL the patient via smartphones… A suggestion to get blood sugar values <100, rather fast.. Friend of mine is using grams of VitC, together with grams of the best magnesium salt, per day, both dissolved in water and sipping on it, every 2 hours...The values dropped from 130 to ~80, within ~2 months. No need for drugs.
The drama of the official medical practices go now in this direction “IS Assisted Dying Being Rushed Due to Covid Complications?“ for anyone who can even bear to listen to it at:
Search in VAERS (https://www.medalerts.org/vaersdb/index.php) for diabetes related deaths after the covid shots and its boosters ends with ‘only’ 193. For exactly the same list of diabetic symptoms, but asking for not recovered cases, VAERS responds: “Found 1,423 cases where Vaccine is COVID19 or COVID19-2 and Symptom is “Diabetes insipidus or Diabetes mellitus or Diabetes mellitus inadequate control or Diabetes mellitus insulin-dependent or Diabetes mellitus management or Diabetes mellitus non-insulin-dependent or … Diabetic cardiomyopathy or .. etc., etc.” and “Did Not Recover“. Thus INSULIN related issues after covid shots can end up with ~13% probability of DEATH, at least. The total death rate for all listed symptoms in all VAERS entries related to covid and bivalent shots is ~2.3%, and that represents possibly only ~1% of all real cases, with the rest not being reported. In the meantime, official science admits, that diabetic patients infected with coronavirus disease 2019 (COVID-19), so frequently affecting none other but the ‘vaccinated’, often have a higher probability of organ failure and mortality (https://link.springer.com/article/10.1007/s11033-023-08504-3). The homology between the amino acids sequence of the Spike2020 (produced by HUMANS after the injected Spike genome) and insulin is extremely important. Just a small section of the only 21 amino acid long insulin amino-acid sequence of its A-chain and the Spike2020 (with 2 homolog sections to it)
Query 83 CC-TSICS 89 INSULIN
CC TS CS <<< IDENTITIES
Sbjct 1236 CCMTSCCS 1242 Spike2020
and continuation of the above Spike fragment
CCTS-ICS INSULIN
CC++ C+ IDENTITIES
CCMTSCCSCLKGCCSCGSCC Spike2020
shows a cysteine pattern which can’t be a random event. Below is shown the 2D insulin sequence with the cysteines from A and B chains building cystine bridges (a) and their role in 3D fold of the synthetic monosaccharide-responsive insulin (https://pmc.ncbi.nlm.nih.gov/articles/PMC8158166/). More on that not trivial process of glucose interacting with insulin at https://www.ncbi.nlm.nih.gov/books/NBK279029/:
Human insulin has its corresponding homologs within other organisms, example of which is described in this report “A minimized human insulin-receptor-binding motif revealed in a Conus geographus venom insulin.“ The overlap of those two is:
Query 1 GVVEHCCHRPCSNAEFKKYC Conus-insulin A chain (con-insulin)
G+VE+CC CS YC <<IDENTITIES
Sbjct 1 GIVEQCCTSICSLYQLENYCN Human insulin A chain
also !!!! CYIQNCPLG <<<HUMAN OXYTOCIN <<<REMEMBER THAT? LOVE hormone
Query 1 TFDTPKHRCGSEITNSYMDLCYR Conus-insulin B Chain
F H CGS + + +C <<IDENTITIES
Sbjct 1 FVNQ-HLCGSHLVEALYLVCGERGFFYTPKT Human insulin B Chain
The above sequence identity coverage is enough for the con-insulin to strongly bind also the human insulin receptor and to activate its receptor signaling. The difference is in the timing. Conus gets its pray by extremely rapid hypoglycemic shock caused by that con-insulin. The goal of the studies? A design of ultrarapid-acting therapeutic insulins (https://www.rcsb.org/structure/5jyq)… Question: like the one ‘homolog’ causing the Hyperglycemia in acute respiratory distress syndrome COVID-19??? Joking.. Oh really? I’m not sure.
And then add to this above this fact:”Two Birds with One Stone: Possible Dual-Role of Oxytocin in the Treatment of Diabetes and Osteoporosis” (https://pmc.ncbi.nlm.nih.gov/articles/PMC4530313/) so now you know why Fauci needed a pardon!!! Human oxytocin has also a role in affecting glucose and insulin homeostasis, as well as regulating body weight balance, thus why on earth giving people Ozempic??
A search of the ‘Human Urine PeptideAtlas’ at https://peptideatlas.org/builds/human/urine/ for that insulin fragment ‘‘CCTSICS” within available human urine data base from 2022, gives 2 hits matching that human insulin fragment, whereby when you do the search within the 2013 data, you will find none, the same with 2010 data base. Why do people in covid times pee out their own insulin pieces? The atlas content increased 15-fold between 2010 and 2022, thus, or the data became more available or indeed the human body is changing. A search for that equivalent Spike2020 piece ‘CCMTSCCS’
is in none of the data bases. BUT, the largest piece of it, the tetrapeptide ‘CCMT’ can be found 9 times within the 2022 data base, 1 time in 2013 data base and ZERO times in 2010. Just for a heck, let’s search for the HIV-homolog piece in Spike, the “KWPWYIW’ peptide. None of the data bases has it in full length, and the largest ‘KWP’ can be found 52 times in the 2022 data base, 5 times in 2013 and only 1 in the 2010 data base, whereby that one piece comes from mannan-binding lectin serine protease 2 isoform X2, connected with sodium conservation in the kidney, salivary glands, sweat glands, and colon, which involves aldosterone, the hormone keeping the pedals on blood pressure regulation. A truly strange result appears when you search the urine data bases for the C-terminal Spike2020 pentapeptide ‘KLHYT’. All the pre-2020 years had it only in just one protein (Dolichyl-diphosphooligosaccharide--protein, DDOST glycosyltransferase), present on all organs, associated with aging and hyperglycemia. The same ‘KLHYT’ search in 2022 data base results in two HUMAN proteins, the DDOST from 2010 and 2013 AND in 2022 a new one, protocadherin, a calcium-dependent cell-adhesion protein present mainly in the brain and reproductive organs, ~40% identical with Spike2020, when using custom BLAST parameters in that search using small fragments! Is there any publication out there finding a connection between those 2? Yes, this one: “Early suppression of antiviral host response and protocadherins by SARS-CoV-2 Spike protein in THP-1-derived macrophage-like cells“ at https://pubmed.ncbi.nlm.nih.gov/36341352/. And here the last sentence from its abstract, quote: “Our study highlights the intrinsic pathogenic role of the S protein and sheds some light on the potential drawbacks of its utilization in the context of vaccination strategies.“ No matter at which Spike2020 brick you look at, the end will lead to a premeditated crime.
Another provocative fact. Were the experiments in 2019 using miR-455-3p molecules modulating high-glucose-induced inflammation in SV40 driven mouse cells and mimicking a diabetic nephropathy (https://pmc.ncbi.nlm.nih.gov/articles/PMC6949587/) a pretest for 2022 research with this title: ‘The emerging role of miRNAs in the pathogenesis of COVID-19: Protective effects of nutraceutical polyphenolic compounds against SARS-CoV-2 infection’ (https://pmc.ncbi.nlm.nih.gov/articles/PMC9346380/#B106 ), in which exactly the same micro-RNA from homo-sapiens labelled as ‘hsa-miR-455-3p’ were able to interact with SARS-CoV-2 genome (part of it got universally injected into human beings) and while having their expression regulated by polyphenols, play an effect on the covid infection???
Injections of mod mRNA in order to later on try to ‘heal’ it with methods found BEFORE the massive injections? Scientists who spend their entire life in disconnected from LIFE labs, possessed by their carriers (https://en.wikipedia.org/wiki/List_of_RNA_biologists) have this ‘diabolic dream’, quote: “By utilizing an appropriate delivery vehicle, these small non-coding RNA could be envisioned as a promising biomarker in designing a practical RNAi-based treatment approach of clinical significance.” (https://pmc.ncbi.nlm.nih.gov/articles/PMC9249409/ ) One of those, Dr. Kornberg, signed the anti-RF Kennedy letter with following remark:
A complete library of all the covid-19 mrRNA genes AND THE RELATED DISEASES can be found at https://pmc.ncbi.nlm.nih.gov/articles/PMC9288248/ and that one particular miR455 gene itself, is described more in detail at https://www.genecards.org/cgi-bin/carddisp.pl?gene=MIR455 . How many ‘covid patients’ or better, covid injected victims and their shedded upon followers, have the following related to MIR455 gene issues: Silicosis, Dental Pulp Disease, Mutilating Palmoplantar Keratoderma With Periorificial Keratotic Plaques, Salivary Gland Adenoid Cystic Carcinoma, Skin Carcinoma??? How about this “New onset of palmoplantar keratosis triggered by COVID‐19 vaccination“ (https://pmc.ncbi.nlm.nih.gov/articles/PMC9874741/)? Dr. Kornberg, any comments??? And this is NOT A JOKE, just came in: https://expose-news.com/2024/12/17/japanese-begin-trial-for-drug-to-grow-new-teeth/… To grow new teeth because of Dental Pulp Disease??? Do you see this ‘create a problem’-’reaction (while enriching themselves)-’solution (more money)’, by one and the same ‘hand’ aiming the ‘old human’ extinction in every single step of this strategy?
Clearly the fact that the top of the ‘scientific cream’ is standing up against RF Kennedy tasks, becomes clearer and clearer, in particular when the signee like Kornberg has his views, few quotes: “The second longstanding challenge that I wish to address is future pandemic preparedness.”, “The solution to this problem will come from RNA therapy.”, ”So small interfering RNA drugs are not only therapeutic but also preventative. They are prophylactic. They will immunize an individual against infection for a period of weeks, if not longer.” (https://technode.com/2022/09/22/beyond-expo-nobel-laureate-roger-kornberg-on-new-solutions-to-health-challenges/) What about INNATE immunity for the lifetime? Oh, does not exist any more, the science magicians erased it, for good, just on time during covid19 crimes. And pre-paid media like ‘Mother Jones’ is parroting the new ‘science’ lies loud and wide: https://www.motherjones.com/politics/2020/05/anti-vaxxers-have-a-dangerous-theory-called-natural-immunity-now-its-going-mainstream/
Allow a very basic ‘sugary’ sidetrack, with some important findings about the Bifido bacteria story, maybe not new to everyone, but worth to consider.
So the more sugar, (whether in pure injested form or derived in process of gluconeogenesis from injested foods, https://bodyhealth.com/blogs/news/the-science-behind-perfectamino-amino-acid-utilization) and its synthetic analogs, of all sorts in the human body, GLUCOSE in particular, the more insulin, which is also a growth hormone (https://pubmed.ncbi.nlm.nih.gov/18465354/ ), is needed in order to transport it inside the cell to give it energy in form of ATP. That energy molecule ATP is an RNA nucleotide with three phosphate groups attached (https://www.ncbi.nlm.nih.gov/books/NBK560599/ and https://bio.libretexts.org/Bookshelves/Introductory_and_General_Biology/Concepts_in_Biology_(OpenStax)/04%3A_How_Cells_Obtain_Energy), thus isn’t it already intuitive that messing with RNA building blocks will affect energy, to even start with??
The missing metabolic pathway of ascorbic acid (Vit C) production from glucose in the human body is a big hindrance in funneling the glucose into that so needed VitC, constantly used up, in largest quantities in the adrenal cortex and the medulla, where it is required in catecholamine biosynthesis. In stress, which includes cancer, it is essential. If that L-gulono-γ-lactone oxidase (GLO) gene had not have been mutated, the regulation of the oversupplied sugary nutrients in humans (https://diabetesjournals.org/care/article/44/2/618/35482/Effects-of-Vitamin-C-Supplementation-on-Glycemic, https://pmc.ncbi.nlm.nih.gov/articles/PMC3254006/ , https://pmc.ncbi.nlm.nih.gov/articles/PMC9182772/) would look very different, in particular, after the major crops for sugar resources were entirely genetically modified, and even the natural resources, like honey, is polluted with chemicals sprayed on us for decades (‘The Dimming’ by Dane Wingington). Dr. Thomas Levy considers humans to be genetic mutants because of the lost ability of VitC production from glucose, present in all other animals, except for only few. His health protocolls are attached at the very end of this post.
Proteins do not consist of sugars, DNA/RNA do, similar to phosphor, element found only in DNA/RNA, but not in proteins. Proteins are getting COATED with sugars in an enzyme supported targeted posttranslational modification process called glycosylation, or they can be randomly glycated. Glycation happens with DNA too, with equally severe consequences, which include reduced transcription of the affected gene and change in resulting protein activity. It appears that even RNA is glycosylated, since 2021 discovery (https://pubmed.ncbi.nlm.nih.gov/34004145/)... Sugars also bind to lipids forming the s.c. glycolipids, components of cellular membranes, including the one which determine the very unique personal feature, the blood type.. All that on top of the universal glycolysis, breakdown of sugar for the ATP production, also involved in carcinogenic reprogramming using the genes indicated in the rectangles below (https://iubmb.onlinelibrary.wiley.com/doi/epdf/10.1002/iub.1251)
With the ever increasing dietary sugar amount in human bodies, an IRREVERSIBLE overcoating in the glycation process happens, which will lead to a change/loss of proteins function, DNA function, entire organ function. In case of hemoglobin, to a reduced OXYGEN delivery to the body (https://pubmed.ncbi.nlm.nih.gov/22985301/). Thus ‘oversweeting’ the essential breathing molecules, the hemoglobins, leads to larger difficulty of getting the oxygen into tissues, all due to the hemoglobin forever being ‘coated’ (chemically bound) with the sugars. No matter how much fresh air is around you, one would need to wait ~4 months for the new red blood cells producing fresh ‘unsweetened’ hemoglobin, which can ‘breath’ again (via binding and carrying O2), unless.. a natural way to stop that sugar sticking is utilized. Substances which interfere with advanced glycation end (AGEs) products, by blocking it are: benfotiamine, luteolin, pyridoxal-5-phosphate, and carnosine. PQQ, R-lipoic acid, and taurine enhance mitochondrial resistance to glycation-induced oxidative stress (https://www.lifeextension.com/magazine/2017/5/combat-sugar-toxicity). Going back to the SAD diet. If you do not change your food, the higher glycated hemoglobin (HbA1c), related to liver health, blood pressure, triglycerides, among others, will give you the new normal, the opposite of building back better, a chronic metabolic disease (https://pmc.ncbi.nlm.nih.gov/articles/PMC8049785/). The overglycated hemoglobin leading to a sweet non-functional ‘paradise’ inside, is called diabetes. In that state, you literally pee the sugar out of your body (urine in diabetics TASTES SWEET). Hopefully the above ruined the appetite for those crispy do-nuts or chocolate prezels;) If not, please continue reading.
Then we got the HIGH-fructose corn syrup everywhere, and the blood sugar monitors are telling you only the glucose part, not the fructose. Does it matter? Both sugars use many the same enzymes for their metabolism, and ~54% of the fructose is converted into glucose in the liver, so do we have the problem here? Fructose is insulin pathway independent, but not when it turns into glucose.. Also there is something like fructose intolerance, which luckily can be treated with VitC and folic acid (https://pmc.ncbi.nlm.nih.gov/articles/PMC9708598/). Well, bad news, quote: “recent transcriptome investigations, demonstrated that the fructose metabolism is altered in patients with SARS-CoV-2 infection.” Further: “We therefore hypothesize that the poor prognosis of cancer patients caused by SARS-CoV-2 may therefore be mediated through fructose metabolism.“ (https://journals.plos.org/ploscompbiol/article?id=10.1371/journal.pcbi.1012412). How comes? Fruits, veggies, the main source of fructose, were always essential for healthy diet, so was there any distinction between these different fructose sources, like the natural and man-made?? And now the fructose metabolic pathway got somewhat changed?? Oh, what do the Bifidos eat? Fructose from a good diet of veggies and fruits, bifidos do not utilize glucose the usual way, their enzyme portfolio is different. Given the current missing Bifidos tragedy, who is going to convert the fructose into moles and moles of ATP (https://pmc.ncbi.nlm.nih.gov/articles/PMC4923077/) in human bodies!!??
Glucose, carried by 9 out of GLUT1 to 14 types of receptors (https://pmc.ncbi.nlm.nih.gov/articles/PMC9368955/pdf/ijms-23-08698.pdf), the main being GLUT4, is regulated by insulin and its receptors, and it is the ‘raw material’ for ribose, deoxyribose, building blocks of genetic material DNA/RNA (https://www.ncbi.nlm.nih.gov/books/NBK560599/), which include the pseudouridine with cancerous properties. How much carbohydrates/sugars is needed in order to sustain/renew OWN targeted glycosylation, cellular membranes restoration, energy production and DNA/RNA production, that unique own DNA everyone was born with??? Not much, all what blood can carry at once is ~5g. Ask Okinawa citizens how much do they eat? Not much, sea veggies most, and they live LONG!!! How much sugar do Americans consume, every day? Well, they have to, there is not much with little sugars in stores to get… And where does this excessive sugar/carbohydrates go? Into liver, turning it with time into FATTY liver, which then tries to convert and store more and more of it, but when the saturation moment comes, liver/pancreas say ‘no more hoarding’ and ignore the growing sweetness while forming ‘insulin resistance’. Where else that sugar is being used for?? Not only for always the same own DNA/RNA ‘replacement’ production in apoptosis events but also everywhere where the FOREIGN GENETIC MATERIAL is being produced, NO 1, your GUT MICROBIOME. Right now everyone carries less and less of the good bacteria, and more, and more of the bad ones (thanks to the genetically modifying foods and the accompanied chemicals like glyphosate which by itself is an antibiotic!). To a level where in covid injected victims and diseased patients, the Bifio-species are gone (https://bmjopengastro.bmj.com/content/bmjgast/9/1/e000871.full.pdf) But WHY Bifidos? This fact is extremely concerning since, quote:”Bifidobacterium is one of the most abundant genera in adults, but its predominance is even more pronounced in infants, especially during lactation, when they can constitute the majority of the total bacterial population.” (https://pmc.ncbi.nlm.nih.gov/articles/PMC5722804/). Dr. Sabine Hazan is the top expert on investigating the lost Bifidos issue in connection with covid19, here one of her interviews: https://x.com/Donuncutschweiz/status/1873255128095953283 .
So if the Bifidos are all gone, thanks to covid genetically modifying injections (the RNA viruses were here for a long time, so it can’t be them..), with what are human guts being filled these days? Chronic constipation is caused by a relative decrease in obligate bacteria, (e.g. Lactobacillus, Bifidobacterium, and Bacteroides spp.) a parallel increase of potentially pathogenic microorganisms (e.g. Pseudomonas aeruginosa and Campylobacter jejuni) (https://pmc.ncbi.nlm.nih.gov/articles/PMC4951383/), thus that must be the reason why the definition of clinical constipation changed from 1 bowel movement per day to 2 per WEEK (per Dr. Nuzum’s)!!! Is that some kind of a new normal UN march into the sustainability direction, in order to save water, paper, etc., while making the human bodies to unattractive baloons causing the obesity epidemic? It is becoming clear that human guts are being filled with antibiotic resistant strains of bacteria, alone due to the worldwide glyphosate pollution, with bifidos being part of it, in particular after adding synthetic genetic mod mRNA to it, and wiping out the rest totally..
Bifidospecies are among the first species colonizing the new growing infants body, that’s the predominant type of bacteria allowing the full utilization of MOTHERS’ (in all mammals including HUMAN) MILK, the food for every baby. Good overview about breastfeeding can be found here: https://articles.mercola.com/sites/articles/archive/2024/12/30/power-of-breastfeeding.aspx
Those who can’t digest diary/milk in general, are LACTOSE-intolerant. Lactose, a disacharide which consists of a galactose and glucose, must be split/digested by the lactase enzyme, which is missing in the intolerant individuals, leading to fermentation, gas production in the guts and to a hindered glucose production. Bifido species improve that lactose digestibility and the fact that they are the ‘first foreigners’ in the human body (wish Biden would invite those all over the borders!), makes them essential in immune system development (https://pmc.ncbi.nlm.nih.gov/articles/PMC9002861/).
Glucose binds 1/5 weaker hemoglobin than galactose and 1/10 weaker than fructose in the blood, thus the least sticky sugar becomes the fuel for the entire body, a real energetic efficiency. In end effect, seems like covid19 targets everybody but the babies most, by not allowing them to utilize their own mothers milk for the growth, while wiping out the friendly life support, the bifidos. Just recently it was shown that bacterial ‘communication’, the quorum-sensing pathway had the strongest effect on the ability of Bifidobacterium to promote glucose homeostasis, suggesting its role in regulating other intestinal microbiota (https://pmc.ncbi.nlm.nih.gov/articles/PMC11622461/). That master conductor role in energy distribution within the microbiome must have been targeted in covid19 injections design, alone via application of plasmids carrying antibiotics resistance. Wait, there is more evil behind.
Another possible reason why the injections are being responsible for that specific annihilation, is because of unlimited supply of Spikes which by DESIGN require/bind lipids, essential building blocks for all gut bacteria. Scientists claim that happens in particular during viral assembly (https://pmc.ncbi.nlm.nih.gov/articles/PMC8486083/pdf/main.pdf), but whether that assembly happens or not, the lipids will bind to the Spike first! And where within Spike??? Well, exactly to that most sulfur rich fragment of Spike so similar to the insulin: 1235-CCMTSCCSCLKGCCSCGSCC-1254. How strange! Scientists tell you in the title that “Polyunsaturated ω-3 fatty acids inhibit ACE2-controlled SARS-CoV-2 binding and cellular entry“ (https://www.nature.com/articles/s41598-021-84850-1) but only deep in text “Among them, linolenic acid, eicosapentaenoic acid (EPA), and linoleic acid had the highest binding affinity to spike protein.” Thus the good fats, in particular the ones building the brain, little baby needs most, the ones with the most ‘curly’ structure on this planet are gone, not the hard trans-fats from McDonald’s. Who else needs those good PUFA’s EPA/DHA’s? Bifido single wall gram-positive, the most electric bugs of all (https://news.berkeley.edu/2018/09/12/gut-bacterias-shocking-secret-they-produce-electricity/) to build their own membranes, to multiply and give the butyric acid everyone needs, the vitamins, and in particular the live saving Vit B2, riboflavin, (https://pmc.ncbi.nlm.nih.gov/articles/PMC5751248/#sec1-ijms-18-02645, https://pmc.ncbi.nlm.nih.gov/articles/PMC4919986/pdf/MBT2-9-441.pdf), the one without which no chicken/egg would exist on this planet..
That lactase enzyme, allowing the baby to get its energy (to grow) from mothers milk, which is tearing apart the lactose (https://www.uniprot.org/uniprotkb/P09848/entry) via this simple reaction:
H2O + lactose = beta-D-galactose + D-glucose
is huge, it has 1927 amino acids but it is only that ONE negatively CHARGED residue E=Glu which determines that capability of that reaction, this SINGLE POINT mutation of that E at the position 1749 in this ‘NDPPIYVT→E←N’ piece will make you to be able or to enjoy that ice cream or be lifted up by an excessive gas production…
The third reason why Bifidos are disappearing in Covid times saturated with synthethic RNA molecules, the most surprising, to me, comes from 1950 publication titled “INTERRELATIONSHIPS BETWEEN RIBOSE AND DESOXYRIBOSE COMPONENTS OF NUCLEIC ACIDS“(https://pmc.ncbi.nlm.nih.gov/articles/PMC385957/pdf/jbacter00605-0061.pdf). What do the bifido species are munching on and what kills them in lab conditions? They need DNA and it is RNA, which kills them, brutally speaking. Here a quote: “In addition to DNA, thymidine, or vitamin B12, Lactobacillus Bifidus is able to utilize for growth desoxyadenylic acid, desoxycytidylic acid, desoxyguanylic acid, thymidylic acid, or hypoxanthine desoxyriboside. Utilization of DNA or the desoxyribonucleotides is inhibited by adenylic acid and ribonucleic acid, and to a lesser degree by guanylic acid, cytidylic acid, and uridylic acid. Utilization of the desoxyribosides of hypoxanthine and thymine is not markedly inhibited by the ribose compounds.” Why is that?
“Competition between the desoxyribose and ribose nucleotides for a nucleotide phosphatase is offered as a possible explanation for the observed inhibitory effects.”
So once again: “The growth of L.Bifidus in the presence of DNA was found (Skeggs et al., 1950)1 to be inhibited competitively by yeast ribonucleic acid (RNA).” Here the diagram how fast that growth inhibition happens:
With knowledge like this for almost 75 years, it must be a clear premeditation of the ‘RNA world’, the ‘new eugenic evolution’, to produce synthetic mod RNA which does not get degraded and reaches the entire digestive system. To decimate species needed for human life means to stay against creation. One of the magician’s example: ”Building blocks for 'RNA world' made from simple ingredients” at https://www.nature.com/articles/nature.2016.19901 with the subtitle: Chemical assembly bolsters theory that life might have begun with RNA. If that was the case, Bifidos would embrace the RNA as their food and not die out in masses like the above 1950 diagram shows. Another source at https://www.ncbi.nlm.nih.gov/pmc/articles/PMC385940/pdf/jbacter00628-0019.pdf found that if ascorbic acid and vitamin B12 were omitted from bifidos growing medium, growth did not occur aerobically.
Bifidobacteria can be greatly propagated/multiplied in cows milk, which can also be fed to little babies. Right now even that part is being targeted, with a much larger motif behind: https://childrenshealthdefense.org/defender/bird-flu-panic-ramps-up-california-declares-state-of-emergency/. Incredible talk, not about bifido though, but covering some other essential bacteria, like L. Reuteri and what do they do to human bodies, how to propagate them and make your own yogurt with them can be found here:
After listening to the above story, truly NOBODY needs Oz-em-PIC, any more. The in that video featured Dr. Davis exlplains the benefits of many probiotics at https://drdavisinfinitehealth.com/super-gut/.
Humanity is really on crossroads of existential survival, in particular California, with H5N1 bird flu emergency inflicting HUMANS, which must be connected with studies which make the bovine version https://www.science.org/doi/epdf/10.1126/science.adt0180 switchable to humans. That gain/loss of function achievement by the ex head of JCSG comes on top of already countless patents for covid-19 genetically modifying injections (20240140993, 11845777,20210139543←self assembling ferritins https://patents.justia.com/patent/20210139543 . Anyone got huge ferritin to neutrophile ratio during ‘covid19’??? So how to make the next great plandemic with one or 2 point mutations in comparison to the old hemaglutinin is out, and possibly embedded into the Self-Amplifying-mod mRNA/mRNA products which are about to be tested on humans by Arcturus Therapeutics (ARCT-2304). The Japanese population is already on its way to the annihilation with that new already approved and being applied never ending gene therapy. The utilization of the Company’s proprietary STARR® self-amplifying mRNA and LUNAR® delivery technologies, are GENE THERAPIES! (Sourced from: https://ir.arcturusrx.com/news-releases/news-release-details/arcturus-therapeutics-announces-second-quarter-2024-financial). Moncef Slaoui, the chief of the Operation Warp Speed is on it too, again… Thus this time, a GENE THERAPY forever, with SA-mRNA described in some of their long patents list: https://www.lens.org/lens/search/patent/list?q=Arcturus Therapeutics, Inc. , with some on the technology https://www.lens.org/lens/patent/106-955-279-178-346/frontpage?l=en and in this one https://www.lens.org/lens/patent/144-359-614-274-210/sequences?si=&t=AA which yesterday was readable, today not…. BARDA Biodefense program support of $63.2M in 2022 already with trials right now (!!) in 2024 (https://ir.arcturusrx.com/node/12936/pdf) for a gene therapy with a synthetic genetic sequence one can’t find anywhere, is just illegal. One can only speculate, that the new injections are maybe having the 2 mutations which allow for exactly that human transmission, to apparently protect them from it…. That’s my speculation. And if the timing of the solution proceeds the incident, we know, it is/was a plan…. Today a new post reviews the clinical studies with much more info on these even more questionable type of synthetic RNA injections:
Back to Kevin McKernan’s news, the DNA contamination issue of covid Pfizer/Mod-E-RNA injections. SV40 was known to cause cancer (https://embryo.asu.edu/pages/asilomar-conference-1975) and was involved in the first genetic experiments with transferring viral genes into E.Coli bacteria. Ask Dr. Baltimore, he knows best!
When looking at the SV40 entire genome (https://www.ncbi.nlm.nih.gov/nuccore/NC_001669.1) one cysteine rich section sticks out, the one in the small t-antigen protein (174 amino acids, code NP_043128.1), and here is what BLAST comes up with when comparing Spike2020:
Query 50 EKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEVFASSLNPG---------------VDA 94
E+ K ++ +++ K DFGGF + +++ P DA
Sbjct 773 EQDKNTQEVFAQVKQIYKTPPIKDFGGF-NFSQILPDPSKPSKRSFIEDLLFNKVTLADA 831
Query 95 MYCKQWPECAKKMSA-NCIC 113 SV40 small t antigen
+ KQ+++C ++A + IC <<IDENTITIES
Sbjct 832 GFIKQYGDCLGDIAARDLIC 851 Spike2020
Query 92 VDAMYCKQWPECAKKMSANCICL 114
V M C C M++ C CL
Sbjct 1230 VTIMLC-----C---MTSCCSCL 1244
here by hand with a shifted Spike section:
MYCKQWPECAKKMSANCICLLCLLRMKHENRKLYRKDP-LVWV << SV40 small t antigen
M C + C C C C ++ + K L +
MLCC-MTSCCSCLKGCCSCGSCC-KFDEDDSEPVLKGVKLHYT << Spike2020
and 2 more fragments, first one automated BLAST result:
Query 128 YRKDPLVWVDCYCFDCFRMWFGLDLC 153 << SV40 small t antigen
Y K+ W++ FR++ + C
Sbjct 145 YHKNNKSWMESE----FRVYSSANNC 166 << SPike2020
YCKQ---WPECAKK-M-SANCICLLCLLR--M--KHEN << SV40 small antigen
Y K+ W E+ + + SAN C + + E
YHKNNKSWMESEFRVYSSANN-CTFEYVSQPFLMDLEG << Spike2020
There is a special work written by B. Robson at https://www.sciencedirect.com/science/article/pii/S0010482520300627 showing that this ‘added’ piece in the first Subjct line ‘KRSFIEDLLFNKV’, representing the Spike2020 amino acid sequence is required for SARS-CoV-2 cell entry..
How do these viruses ‘remember’ so much about SV40 and then insert just one piece which makes them so welcome into the human body, again, under a different name? I’m sure again, Dr. Baltimore, and Dr. Fauci (born on the 24th of Dec.), for sure, can answer that! Amazing coincidences indeed.
The SV40 early promoter has 6 repeat motifs 5'-CCGCCC-3' essential for its in vivo activity (https://pubmed.ncbi.nlm.nih.gov/3004974/ ) and strangely that’s the complementary middle piece (read backwards and exchange C→G, and G→C) in that Moderna patented sequence ‘CTCCTCGGCGGGCACGTAG‘. Spike sequence does not have that exact SV40 repeat motif, but it has this ONE pattern, into which some CRISP tools could bite in and get that T out, maybe?? That’s the Spike’s genome fragment from the entry at https://www.ncbi.nlm.nih.gov/nuccore/NC_045512
25081 tgcttcagtt gtaaacattc aaaaagaaat tgaCCGCCTC aatgaggttg ccaagaattt
In any case, Spike2020 homologies between the SV40 large T antigen are the same and very disturbing for most part, with even more fragments, except for the C-rich section, here just one example:
Query 427 PIDSGKTTLAAALLELCGGKALNVNLPLD------RLNFEL-GVAIDQ 467 NP_043127.1
P+ KT++ ++ +CG + NL L +LN L G+A++Q
Sbjct 728 PVSMTKTSVDCTMY-ICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQ 774 Spike2020
Let’s not imagine a horror scenario with this question, is the strange ‘shedding’ from the covid injected some kind of SV40 coupled transmission in which the promoter might interact with Spike, which simulates the LTA?? Just a speculation, but the fact that SV40 ORI with the LTA protein is responsible for horizontal transmission (from one organism to the other) was described already in 2007 (https://pmc.ncbi.nlm.nih.gov/articles/PMC1941725/)?? The part relating SV40 LTA proteins (and so the Spike2020) to cancer, via glucose metabolism pathway, was also described: ”The SV40 Large T Antigen-p53 Complexes Bind and Activate the Insulin-like Growth Factor-I Promoter Stimulating Cell Growth” (https://aacrjournals.org/cancerres/article/68/4/1022/542775/The-SV40-Large-T-Antigen-p53-Complexes-Bind-and). Kevin McKernan talks about the shedding more at: https://uncutnews.ch/selbstverstaerkender-impfstoff-die-gefahr-replizierender-dna-plasmide-die-von-geimpften-auf-andere-uebergehen-koennten/ On 12/23/24 SV40 DNA from Pfizer and Mod-E-RNA was found in the blood of 75 ‘vaccinated’ Australians, plus the autopsies of the covid injected with SV40 DNA present in their cancerous organs are out there too..
Regarding this glucose dependent growth alert in these covid times, there is that strange GIANT consortium (The Genetic Investigation of ANthropometric Traits), (not sure Francis Collins is in it https://portals.broadinstitute.org/collaboration/giant/index.php/GIANT_consortium), which is very much interested in Type II Diabetes according to “Functional genomics of human skeletal development and the patterning of height heritability“ (https://www.cell.com/cell/fulltext/S0092-8674(24)01256-X). The fact, that this GIANT consortium is affiliated with BROAD Institute (MIT, Harvard), so heavily involved in design of covid19 genetically modifying injections, is very much concerning, but maybe justified. Maybe? Here is what the scientists are telling us about us, humans, with just one picture, from top science journal (https://www.nature.com/articles/d41586-024-04194-4), mind you, there is no woman…:
and just for fun, kind of inverted evolution in terms of size, this would actually correspond more with the NIH+Co gigantic interests:
substantiated by more old pictures, movie, documents, from a source, I’ll leave out for now, and only share this thought, maybe NIH+Co. are taking the biblical Goliath and David story somewhat seriously..??
Since genetics, and glucose, determine this ‘dimensions/energy feature’, as shown on this one point mutation event above and as a consequence utilization of mothers milk for growth, one needs to consider this most recent nature genetics paper “A multilineage screen identifies actionable synthetic lethal interactions in human cancers“ (https://www.nature.com/articles/s41588-024-01971-9) saying in the first sentence, quote “Cancers are driven by alterations in diverse genes, creating dependencies that can be therapeutically targeted.“ This quote talks about alteration in genes in different people though. Since your genes always stay the same since your birth, why didn’t you have that cancer years back? In addition to epigenetic changes of gene’s expression thanks to good or toxic chemicals, how about inserting NEW GENES, like pieces of Spike, like SV40, for example via covid shots? Also the lifetime of a plain DNA molecule can be thousands of years, when left alone and properly stored, but not when adding DNA/RNA restriction/digestive enzymes, which cut and paste the original genetic material to a level of a wild zoo, the end result of which is shortened lifespan…. Effects on human bodies of random genetic mutations caused by radioactive radiation are known very well. Please listen to this short section, if you are bored by now, around 31:50 at https://www.bitchute.com/video/5G8ObLVkONL1, it is about the possible life span of Marshal Islands inhabitants before and after 1960, a difference of ~150 years, ‘thanks’ to mutations caused by a nuclear radiation. Anyone more Jasons, Ukraine labs, lost nuclear material??
That point of building genetic material using sugars, as one component, is also connected with using one very specific amino acid GLYCINE derived from SERINE for that production in the s.c. ONE CARBON metabolism, which is essential in cancer (https://www.nature.com/articles/nrc.2016.81). And since serine is the building block for glycine production, that simple nonpolar amino acid is linked to cancer as well (https://www.science.org/doi/10.1126/science.1218595). One of these links is the fact that phosphatidylserine, defined as negatively charged lipid, is a part of an intracellular layer of normal cell membrane, but in cancer, it ends up in increased cell surface exposure, following immune suppression and cancer growth.
In the meantime, FDA prepares for the future: “Final FDA Guidance Lays Path for Drugmakers to Establish Circulating Tumor DNA as Trial Endpoint“ at https://www.genomeweb.com/cancer/final-fda-guidance-lays-path-drugmakers-establish-circulating-tumor-dna-trial-endpoint. Is that the cDNA injected into the billions of arms??? That must be why Gottlieb wants RF Kennedy Jr out so much… Please pray for RFK Jr.’s mission to be accomplished.
Dr. Jack Kruse, a well known surgeon (student of the late Robert O. Becker, father of electromedicine) is touching the Ozempic blues and all so ‘sweet’ GLP-1 agonists, Glucagon-Like Peptide-1, a 30- or 31-amino-acid-long peptide hormone derived from the tissue-specific posttranslational processing of the proglucagon peptide (https://diabetesjournals.org/clinical/article/38/4/390/35426/Switching-Between-Glucagon-Like-Peptide-1-Receptor), in this podcast at:
Dr. Kruse goes even further and combines the SV40 cancer story with JFK 1963 assassination:
GLP-1, described at https://www.uniprot.org/uniprotkb/P01275/entry is a potent stimulator of glucose-dependent insulin release. Upon food intake GLP-1 (brown helix below, that’s what Ozempic is ‘mimicking’) is excreted by intestine lining and with glucose around it binds its receptor (green) while stimulating pancreas to produce insulin.
So many people wish to loose some weight. Well, we can’t change the gravity constant, but when you ‘get covid’, the weight loss comes with it, thus no need for Ozempic. Besides, before ever ‘going on it’ you better check this list of 266 (!) drugs interacting with Ozempic: https://www.drugs.com/drug-interactions/semaglutide,ozempic-index.html
There are some ‘drug oriented’ scientists, who didn’t see the above list and think diabetics might need Ozempic, summarizing their findings (https://pmc.ncbi.nlm.nih.gov/articles/PMC10500111/pdf/HSR2-6-e1549.pdf) with the title “The impact of preadmission/prediagnosis use of GLP‐1 receptor agonists on COVID‐19 mortality in patients with diabetes: A systematic review and meta‐analysis“. GLP-1 RA drugs, which stimulate insulin production are reported by few more groups to have positive outcome in covid19 treatment. But more insulin also leads to insulin resistance, since cells do have only given amount of the receptors on their surfaces… And that’s just a ‘mild issue’, the weight loss program can also end up with cancer, paralized stomach or blindness (https://childrenshealthdefense.org/defender/ozempic-semaglutide-vision-loss-study-side-effects/)… And this : https://x.com/Donuncutschweiz/status/1869332782440390978 tells really enough in order to sue Novo Nordisk for their product.
Search of PubMed (https://www.ncbi.nlm.nih.gov/pmc) for published articles involving two keywords ‘SARS-CoV-2 insulin’ results in 19710 publications connecting the greatest PLAN-demic with the NO 1 ‘energy’ hormone of the humankind, insulin, amino acids sequence of which was decoded by the geneticist Frederick Sanger in 1951. Insulin amino acid residues from its B chain, Tyr16, Tyr26, F24 and F25, His10 and Glu13 participate in its receptor binding (https://pmc.ncbi.nlm.nih.gov/articles/PMC8513149/pdf/main.pdf). They are marked below with * under the amino acid sequence (single letter code) of the B chain overlapped with the Spike2020:
1 10 20
FVNQHLCGSHLVEALYLVCGERGFFYTPKT INSULIN CHAIN B
* * * *** <= INSULIN residues binding the insulin receptor
overlap with Spike2020:
FVNQHLCGSHLVEALYLVCGERGFFYTPKT INSULIN, CHAIN B
VN + + L A Y + RG +Y K IDENTITIES
CVNLT-TRTQLPPA-YTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFF-SNVTWFHAIHV <=SPIKE2020
and continuation of Spike sequence from the above
FVNQHLCGSHLVEALYLVCGERGFFYTPKT INSULIN, CHAIN B
F L H + L+L +FF + T
FRSSVL---HSTQDLFL-----PFF-SNVTWFHAIHV <=SPIKE2020
The coverage of 11 in total residues identical or homolog to insulin in the TWO Spike fragments, and the fact that the same residues binding the insulin receptor are among them, seems to be strange. It is almost as if the mimic of insulin allows Spike fragments binding to the insulin receptor on the cell surface, thus allowing for easier viral entry, maybe? Well this publication at https://pmc.ncbi.nlm.nih.gov/articles/PMC9756566/pdf/main.pdf titled “Insulin may promote SARS-CoV-2 cell entry and replication in diabetes patients“ indeed describes the clinical findings confirming that..
Some basics from 1922 at https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2417009/pdf/brmedj06741-0003.pdf :
→ ratio of how much CO2 is exhaled in breathing to how much O2 is left (also proportional to lung quality/size being indicator of longevity!!!) was reported to be 1 for carbohydrates diet, 0.7 for fats and 0.8 for proteins. That ratio indicates the level of glucose oxidation. Removal of pancreas (in the experimented dogs!) ends with diabetes, in which the value of 1 falls below 0.7, due to impaired carbohydrate digestion. What else happens in the victimized dogs? Acetone bodies and sugar appear in urine, glycogen from liver disappears and in the heart it grows way above the normal. Fat disappears from the liver and the blood. Administration of insulin rescues the pancreas-less victim.
The ‘pre-designed’ presence of sugar in all foods driving the insulin spikes, is an evil tactics of food industry. But now it is in the hands of smart scientists: “‘Smart’ insulin prevents diabetic highs — and deadly lows“ or exactly quote “Scientists have designed a new form of insulin that can automatically switch itself on and off depending on glucose levels in the blood. In animals, this ‘smart’ insulin1 reduced high blood-sugar concentrations effectively while preventing levels from dropping too low.“ And that’s how the ‘smart’ crystals look like (https://www.nature.com/articles/d41586-024-03357-7):
This is NOT how classical symmetry looks like, 1-,2-,3-,4-,6-fold symmetry!
Insulin, the OLD one, has MANY FUNCTIONS (https://www.uniprot.org/uniprotkb/P01308/entry) and it is not only about carbohydrates, but equally about regulation of lipid formation/breakdown. That’s because of that fat conversion in the liver when in oversupply. Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. It is the main anabolic hormone of the body, and it is a fat storage hormone, which inhibits lipase, the fat burning enzyme. The regulation of the metabolism of carbohydrates, fats, and proteins by promoting the absorption of glucose from the blood into cells of the liver, fat, and skeletal muscles, is an indication for a masterminded insulin driven energy distribution. That’s from wi-ki and uniprot, reinterpreted.. Not much about the brain. Why? When you look at the latest PET Japanese study of covid un-jabbed (A and B) vrs. jabbed (C and D) at https://pubs.rsna.org/doi/epdf/10.1148/radiol.230743 (the entire study is at https://pubmed.ncbi.nlm.nih.gov/37724969/), you see there is LOT of the unhealthy sugar derivative 18Fluorine-fluorodeoxyglucose (POOR patients!) in the brain AND you have a lot of that ‘sugar’ in the heart of the jabbed in C and D, exactly there, where it should NOT be, like in A and B, hearts of the unjabbed:
That 1922 study explained already partly what we see here.. The above pictures indicate a LACK OF insulin in heart tissue, which would ‘take away’ the sugar from those jabbed ‘diabetic’ hearts… Heart has one of the highest concentrations of ACE2 receptors to which the sugar-hungry Spike will bind. Does this maybe indicate that the FFG-sugar binds the Spike instead? Another experiment, from 1927 at https://pmc.ncbi.nlm.nih.gov/articles/PMC1514894/pdf/jphysiol02513-0044.pdf is helping in understanding exactly that situation “THE ACTION OF INSULIN ON THE ASEPTICALLY PERFUSED HEART.“ quote:
“accelerated disappearance of sugar, from the fluid perfusing an isolated mammalian heart, under the influence of insulin, is a real phenomenon, and is not connected with bacterial contamination of the perfusion fluid. …a large acceleration of sugar disappearance may occur without any significant acceleration of the heart beat. From analogy with the effect of insulin on skeletal muscle it would be expected that part of the glucose so disappearing is stored as glycogen;“ More on the details at https://biologyinsights.com/aerobic-respiration-pathways-atp-yield-and-cellular-functions/
Now to some homologies between human pro-insulin entire sequence of 110 amino acids (we covered one part only) and the SARS-CoV-2 Spike sequence, the one genes of which were injected into billions of arms, illegally, because without a consent to undergo GENE THERAPIES. The NIH BLAST software finds the following identities, most important one, the already discussed cysteine rich C-terminal section of human insulin A6XGL2 (uniprot code), and here more:
'GIVEQ-CCTSICS-LYQLENYCN being a SEQ1 in 2001 filed patent for 'Use of insulin for the treatment of cartilaginous disorders.' by GENENTECH.
the first 24 N-terminal insulin amino acids, representing the signal for expression:
MALWMRLLPLLAL--LALWGPDPAA-A expression signal of INSULIN
M ++ LLPL+++ + L ++ +
MFVFLVLLPLVSSQCVNL-----TTRT expression signal of SARS-CoV-2 SPike
is =>15/24*100%~62% IDENTICAL with Spike2020 signal!
it means that the expression of SPike2020 is maybe somewhat synchronized with insulin secretion, to allow for the max steal of the building blocks necessary to assemble SPike2020, and NOT insulin?? Just a thought..
And even more homolog insulin fragments:
Query 33 SHLVEALYLVCGER 46 Insulin
L+ A VCG +
Sbjct 515 FELLHAPATVCGPK 528 Spike2020
Query 46 RGFFYTPKTRREA 58 Insulin
RG +Y K R +
Sbjct 34 RGVYYPDKVFRSS 46 Spike2020
Query 52 PKTRREAEDLQGSLQPLALEGSLQKRGIVEQ 82 Insulin
P R EDL L + +L G ++Q
Sbjct 812 PSKRSFIEDL------LFNKVTLADAGFIKQ 836 Spike2020
Query 54 TRRE-AEDLQGSLQPLALEGSLQKRG 78 Insulin
++R EDL + LA G +++ G
Sbjct 813 SKRSFIEDLLFNKVTLADAGFIKQYG 838 <<< Spike2020's 'hammer' section
Query 17 WGPDPAAAFV 26 Insulin
W AA +V
Sbjct 258 WTAGAAAYYV 267 Spike2020
Query 29 HLCGSHLVEALYLVCGERGFFYTPKTRREAE 59
H +H+ +V +F T + E +
Sbjct 1083 HDGKAHFPREGVFVSNGTHWFVTQRNFYEPQ 1113
part of furin site:
Query 56 REAEDLQGSLQPLALEGSLQKRGIVEQCCTSI 87
R A + S +A SL V SI
Sbjct 682 RRARSV-ASQSIIAYTMSLGAENSVAYSNNSI 712
Query 64 SLQPLALEGSLQKRGIVEQCCTSICSLYQLENY 96
+L PL+ K VE+ +YQ N+
Sbjct 292 ALDPLSETKCTLKSFTVEK------GIYQTSNF 318
Since NIHs BLAST can't any better, here by hand the entire PATENTED cystein rich section in Spike2020 overlapping the homolog PATENTED section of HUMAN insulin:
GIVEQCC-TSICS-LYQL--------ENYCN <<<INSULIN
++ CC TS CS L + + <<IDENTITIES !
VTIMLCCMTSCCSCLKGCCSCGSCCKFDEDD <<<Spike2020
and one more time the same by GENENTECH patented fragment with the SPike2020,
shifted to the second rich cys section:
GIVEQ------------CCTSI-CSLYQLENYCN <<<INSULIN
++ CC++ C+ + + + <<IDENTITIES !
VTIMLCCMTSCCSCLKGCCSCGSCCKF---DEDD <<<Spike2020
Genentech patent at https://www.lens.org/lens/patent/026-563-655-881-535/fulltext specifies how much of amino acid sequence is needed in order to preserve the ‘insulin character’. Patent calls for minimum 15 resides in Chain A, we got 11 overlapping residues. Short way to go CRISP addicts! Here some of their recent claims: https://www.npr.org/sections/shots-health-news/2024/12/13/nx-s1-5227283/crispr-rare-genetic-disorders-gene-editing, https://www.nature.com/articles/s41587-024-02512-9
An example of BLAST alignment of the above closely related insulin and insulin growth factor (IGF-1) with uniprot code of P05019, both of HUMAN origin:
Query 28 QHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQGSLQPLALEGSLQKR----GIVEQC 83
+ LCG+ LV+AL VCG+RGF++ +P GS +R GIV++C
Sbjct 51 ETLCGAELVDALQFVCGDRGFYFN--------------KPTGY-GSSSRRAPQTGIVDEC 95
Query 84 CTSICSLYQLENYC 97 <<< INSULIN
C C L LE YC
Sbjct 96 CFRSCDLRRLEMYC 109 <<< IGF-1
and one more fragment
Query 49 FYTPKTRREAEDLQGSLQPLALEGSLQKRGI 79
+ P T + + P + G QK G+
Sbjct 135 YQPPSTNKNTKSQRRKGWPKTHPGGEQKEGT 165
since insulin also affects the natriuretic peptide, is Spike there somewhere too?
Query 57 VVPPQVLS-EPNEE-AGAALSPLPEVPPWT 84 P01160 Natriuretic peptides A
V+PP +L+ E + + +AL +WT
Sbjct 860 VLPP-LLTDEMIAQYT-SALLAGTITSGWT 887 Spike2020
Query 57 VVPPQVLSEPNEEAGAALSPLPEVPPWT 84 P01160 Natriuretic peptides A
+ P S + AGAA ++ + P T
Sbjct YLTPGDSSSGW-TAGAAAYYVGYLQPRT Spike2020
ANGIOGENIN (P03950) a ribonuclease involved in ALS and Parkinson, critical in cancer growth and supply of new blood vessels, which is controlled by glucose concentration. Here its 2 active centers and how well they align in the homolog section of Spike2020:
active site *, that H below is histidine
Query 28 SRYTH-FLTQHYDAKPQ 43 ANIOGENIN
S TH F+TQ+ PQ IDENTITIES
Sbjct 1097 SNGTHWFVTQRNFYEPQ 1113 Spike2020
active site * histidine138
Query 135 LPV--HLDQ 141 ANGIOGENIN
+PV H DQ IDENTITIES
Sbjct 620 VPVAIHADQ 628 Spike2020
all coincidence???
As one can see that cystein rich section (in bold), containing the by Fauci patented HIV-1 drug with the pattern CxxxxC (cysteine plus any 4 amino acids plus cys again), aligns equally well if not better with Spike2020 than with the physiologically related HUMAN growth factor.
With so many common blocks between HUMAN insulin and countless other proteins which depend on it and the universally injected VIRAL Spike2020, question, will that sudden synthetic production of a new universally injected synthetic gene affect insulin production and the processes glucose is involved with??? The full insulin 110 amino acids uniprot entry P01308 compares following way with Spike:
That's what BLAST comes up with, overlap over almost the entire length of the insulin, it ignores the important fragments which were listed before:
Query 23 AAFVNQHLCGSHLVEALYLVCGER--GFFYTPKTRREAEDLQVGQVELGG--------GP 72
A F+ Q+ + A L+C ++ G+ P + Q L G G
Sbjct 831 AGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGA 890
Query 73 GAGSLQPLALEGSLQKRGI 91
GA P+A++ + + GI
Sbjct 891 GAALQIPFAMQMAYRFNGI 909
That entry P01308 actually defines the PRO-insulin as heteroDIMER consisting of:
25-54 insulin B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKT
57-87 C peptide EAEDLQVGQVELGGGPGAGSLQPLALEGSLQ
90-110 Insulin A chain GIVEQCCTSICSLYQLENYCN
->Zn-binding site of Insulin Bchain
* H=His
Query 22 SHLVE---ALYLVCGERGFFYTP-KT 26 Insulin B-chain
++ + A Y + RG +Y P K
Sbjct 34 TR-TQLPPA-YTNSFTRGVYY-PDKV 38 Spike2020
Insulin chain B binds ZINC at the His10 position (pdb code 1G7A), and is important for proper functioning of insulin‑secreting cells (https://www.thieme-connect.com/products/ejournals/pdf/10.1055/s-0038-1676241.pdf). ZINC is essential for β-cell function, insulin action, glucose homeostasis and the pathogenesis of diabetes and its complications (https://pmc.ncbi.nlm.nih.gov/articles/PMC4573932/). Everything known about Zinc in drug industry can be found at: https://go.drugbank.com/drugs/DB01593#BE0005831 and another resource is at https://jn.nutrition.org/article/S0022-3166(22)14102-7/fulltext. ZINC is responsible in our bodies for a proper functioning of >300 enzymes!!!!! Imagine a car and how far can it get without 300 ESSENTIAL parts in it….
Going back to glucose oxydation and CO2 dependence (breathing and energy), gluconeogenesis requires bicarbonate as substrate and that brings the fastest enzyme in the human body into the play, carbonic anhydrase, which catalyses reversible transformation CO2 + H2O ↔ HCO3− + H+ and which also won’t happen without zinc (https://pmc.ncbi.nlm.nih.gov/articles/PMC7717713/). The No 1 source of zinc in our diets is meat, shelfish and legumes. If you ever notice your fingernails are starting to get vertical streaks like this:
or also at: https://zinc.truecellularformulas.com/drz or here another one: https://drjockers.com/test-zinc-levels-home/
that’s a time to go to your local farmer and reward him for nice piece of beef and some beans, or get a can of oysters every day… Lack of zinc will effect your strength to fight off diseases, you are ‘delivered’ without that crispy element… A good overview of how Zn affects diabetes can be found at: https://pmc.ncbi.nlm.nih.gov/articles/PMC4573932/pdf/40199_2015_Article_127.pdf
Since it is about BREATHING and energy, the fastest enzyme in the human body, and how does it relate to covid or its SPIKE, so heinously used as a pretext for all covid injection materials, one needs to look into it closer. First the comparison of insulin receptor https://www.uniprot.org/uniprotkb/P06213/entry with Spike2020:
Query 1168 AHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPE 1206 <<=insulin receptor
A + +K+ +F D + YY K K WM E
Sbjct 123 ATNVVIKVCEFQFCNDPFLGVYYHKNNKS-----WMESE 156 <<-Spike2020
Query 717 SQILKELEESSFRKTFEDYLHNVV 740
SQIL + + S R ED L N V
Sbjct 803 SQILPDPSKPSKRSFIEDLLFNKV 826
Query 1285 EIVNLLKDDLHPSFPEVSFFHS 1306
+++ +D P F V++FH+
Sbjct 46 SVLHSTQDLFLPFFSNVTWFHA 67
Query 242 NCSQPDDPTKCVACRN 257
N PDD T CV N
Sbjct 422 NYKLPDDFTGCVIAWN 437
Query 279 RCVNFSF 285
+CVNF+F
Sbjct 537 KCVNFNF 543
Query 868 HLMWQEPKEPNGLIVLYEVSY 888
HLM P+G++ L+ V+Y
Sbjct 1048 HLMSFPQSAPHGVVFLH-VTY 1067
Query 91 FRVYGLESLKDLFPNLT 107
FRV ES+ FPN+T
Sbjct 318 FRVQPTESIVR-FPNIT 333
Query 972 IGSIYLFLRKR 982
S+Y + RKR
Sbjct 347 FASVYAWNRKR 357
Query 1235 QPYQGLSNEQVLKFVMDGGYLDQPDNC--PERVTDLMR-MCWQFN 1276
QPY+ + VL F + L P P++ T+L++ C FN
Sbjct 506 QPYRVV----VLSFEL----LHAPATVCGPKKSTNLVKNKCVNFN 542
and this special one KIGDFGMTRDIYETDYYRKGGK of functional importance^1:
Query 16 YYRKGGK 22
YY+K K
Sbjct 144 YYHKNNK 150
insulin receptor shares ~30% identity with GLP-1. Spike comparison
with 6X18_6 (pdb):Glucagon-like peptide 1 receptor P43220.2
Query 60 TEDPPPATDLFCNRTFDEYACWPDGE-PGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGL 118
T+ PP T+ F + +PD S ++ + +LP+ S+V H G
Sbjct 22 TQLPPAYTNSFTRGVY-----YPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGT 76
Query 119 WLQKDNSSLPWRD 131 P43220.2 = GLP-1
+ DN LP+ D
Sbjct 77 K-RFDNPVLPFND 88 Spike2020
Query 453 SSGATAGSSMY 463 GLP-1
SSG TAG++ Y
Sbjct 255 SSGWTAGAAAY 265 Spike2020
Query 110 YRFCTAE--GLWLQKDNSS 126 GLP-1
++FC G++ K+N S
Sbjct 133 FQFCNDPFLGVYYHKNNKS 151 Spike2020
Query 113 CTAEGLWLQKDNSSLPWR 130
CT + + D + WR
Sbjct 617 CTEVPVAIHADQLTPTWR 634
Query 47 FDEYACWP 54
+++Y WP
Sbjct 1206 YEQYIKWP 1213
Query 85 CTAEGLWLQKDNSSLPWR 102
CT + + D + WR
Sbjct 617 CTEVPVAIHADQLTPTWR 634
Facit from all of these BLAST comparisons above: certain single amino acids left after a complete digestion of every piece of food are precursors for many neurotransmitters allowing for all the ‘connections’ within the entire body, every new protein within human body is made from SINGLE AMINO ACIDS, produced only after a complete healthy digestion. Thus ignoring the fact that the Spike synthetic gene steels SO MUCH building materials, and that maybe at all times, is just mindblowing. I’m not even talking about a foreign gene embedded into a human genome here!
Some of the glucose binding GLUT receptors from 1 to 12, regulated by the insulin, https://pmc.ncbi.nlm.nih.gov/articles/PMC9368955/ in addition to glucose and other sugars bind also melatonin and oxidized VitC, depending on the organ, how frequently it is used, how much energy it needs, etc.. GLUT-4 in particular has its name “insulin-responsive glucose transporter” for its relocation from intracellular vesicles to the plasma membrane upon insulin signaling. Disruption of the regulated GLUT4 trafficking is associated with obesity and the type II diabetes mellitus. Accessive sugars can do the same to GLUT4 what HIV protease inhibitors, like Ritonavir, which all cause acute insulin resistance and result in increased diabetes incidence among AIDS patients treated with these inhibitors! (https://onlinelibrary.wiley.com/doi/epdf/10.1002/pro.2858).
When melatonin and VitC bind and affect the glucose receptors? Melatonin for example, is excreted mainly in the night, so one should expect titles like these: “Switching diseased cells from cytosolic aerobic glycolysis to mitochondrial oxidative phosphorylation: A metabolic rhythm regulated by melatonin?“ (https://onlinelibrary.wiley.com/doi/abs/10.1111/jpi.12677), or “Melatonin and Pathological Cell Interactions: Mitochondrial Glucose Processing in Cancer Cells“ (https://pubmed.ncbi.nlm.nih.gov/34830375/) or “Anti-Warburg Effect of Melatonin: A Proposed Mechanism to Explain its Inhibition of Multiple Diseases“ (https://pubmed.ncbi.nlm.nih.gov/33466614/) or “Melatonin Signaling a Key Regulator of Glucose Homeostasis and Energy Metabolism“ (https://pmc.ncbi.nlm.nih.gov/articles/PMC6651071/pdf/fendo-10-00488.pdf) and so many more. Melatonin, the open pandora box in covid times (https://pubmed.ncbi.nlm.nih.gov/33741691/) currently leads to a situation where you won’t get even the 20mg supplementation in your health store any more, sold out. Great, people finally got it!
The mentioned oxidized Vit C form has its name: Dehydroascorbate (DHA) (https://watermark.silverchair.com/32-6-545.pdf ). It inhibits the uptake of 2-deoxy-D-glucose and of 3-O-methyl-D-glucose by human blood neutrophils (https://www.nature.com/articles/s41467-021-26829-0.pdf ) On the other hand this link makes the difference between health and disease : “2-Deoxy-D-glucose couples mitochondrial DNA replication with mitochondrial fitness and promotes the selection of wild-type over mutant mitochondrial DNA“. Not only that, dehydroascorbate has a special function (https://pubmed.ncbi.nlm.nih.gov/19686035/) linking the ascorbate metabolism with oxidative protein folding. VitC upon entry in CNS system functions as a neuromodulator, enzymatic cofactor, and reactive oxygen species (ROS)scavenger; it also stimulates differentiation, which is the reason why Dr. Paul Marik uses the infusions of that vitamin to fight septic shock, which will be always also involving glucose (https://pmc.ncbi.nlm.nih.gov/articles/PMC4126260/pdf/nihms609574.pdf). The literally cruel witch hunt behind Dr. Marik’s EXPERIMENTAL covid findings, was and still is, mindblowing, ending with countless published ‘science’ papers claiming the totaly opposite, Vit C is useless in covid disease.. Dr. Marik is not alone with his recommendation of VitC therapy, I’m attaching at the end protocol of Dr. Thomas Levy, who asked to distribute it far and wide. It is unprecedented, but it looks like the fight for the HUMAN BODY becomes the last battle on this planet. Here the same top journal fabricating the EUA for covid injections, now claims, VitC will kill you when you have covid and land in ICU: https://www.nejm.org/doi/full/10.1056/NEJMoa2200644 . Please, do NOT land in ICU. Here one article describing VitC usage in other diseases, including sepsis (https://pmc.ncbi.nlm.nih.gov/articles/PMC9708598/).
Also this discussion with Dr, Merik and Steve Kirsch might be of interest: https://rumble.com/v5yagjq-vsrf-live-156-the-sepsis-epidemic.html
As much as insulin production is important, so is its degardation. Insulin-degrading enzyme (IDE), is a Zn2+-metalloprotease, involved in the clearance of insulin and amyloid-beta and many other short peptides(refs 1-3), all requiring zinc. Loss-of-function mutations of IDE in rodents cause glucose intolerance and cerebral accumulation of amyloid-beta, whereas enhanced IDE activity effectively reduces brain amyloid-beta (refs 4-7) (from abstract at https://www.rcsb.org/structure/2G54) Thus the new marker for Alzheimer disease is insulin, as reported in article with this title:”Glucose Metabolism is a Better Marker for Predicting Clinical Alzheimer’s Disease than Amyloid or Tau”.
The synthetic crazy expensive monster OZEMPIC (https://pdb101.rcsb.org/global-health/diabetes-mellitus/drugs/incretins/drug/semaglutide/semaglutide) paralyzing human stomachs is based on chemical mutilation of the natural sequences of GLP-1, the one patented by Dr. L. Walensky, husband from Dr. R. Walensky, who introduced the so ‘safe and effective’ Spike synthetic genes… First Ozempic with only the blue being natural:
Now the GLP-1-RGR in 2016 patented sequence from Dr. L. Walensky so similar to Spike2020 (https://www.ncbi.nlm.nih.gov/protein/APN27348
):
HDEF-ERHAEGTFT-SDVSSYL-EGQ------AAKEFI-AWLVKG+RGR GLP-1+RGR << husband
+ F E T +D+ ++ + AA++ I A G
KRSFIEDLLFNKVTLADAG-FIKQYGDCLGDIAARDLICAQKFNG Spike2020 << wife
=============
^^^^^^^^^^^^^
fragment so needed for SARS-CoV-2 infection!!!!
“Stabilized insulinotropic peptides and methods of use”
That’s the title of that patent filed already in 2011 (https://www.lens.org/lens/search/patent/list?q=US%209296805)
Do we need to wonder why the GLP-1 imitating Ozempic suppose to be so helpful in covid19? Some explanation how it works at: https://pmc.ncbi.nlm.nih.gov/articles/PMC8425441/ with the title “The role of GLP-1 receptor agonists during COVID-19 pandemia: a hypothetical molecular mechanism“. Or just lets throw few more titles:
“ACE2 and SARS-CoV-2 Infection: Might GLP-1 Receptor Agonists Play a Role?“
“Anti-inflammatory effects of GLP-1 in patients with COVID-19“
“Friend or foe? ACE2 inhibitors and GLP-1R agonists in COVID-19 treatment“
There are more drugs based on GLP-1 3 D structure, here another candidate, at: https://pdb101.rcsb.org/global-health/diabetes-mellitus/drugs/incretins/drug/tirzepatide/tirzepatide , the one Mr. Musk is ‘on’, apparently. If you ever really need help with loosing weight, maybe the best is no 1, eat less and only organic, no 2 get enough of all the single amino acids (the blue ones) from which your body will assemble the GLP-1 on its own… There are also resources offering the natural GLP-1 peptide (nonpatented, thus cheap..), mentioned in this interview: https://www.brighteon.com/139f5139-ef1a-496a-8165-26f8e7986016.
GLP-1 and GLP-2 are parts of larger protein GLUCAGON (https://www.uniprot.org/uniprotkb/P01275/entry) a counterregulatory hormone of insulin, it stimulates insulin release depending on glucose availability and it regulates the glucose levels in the blood. GLP-1 has growth-promoting activities on intestinal epithelium, suppresses satiety and stimulates glucose disposal in peripheral tissues, regulates the hypothalamic pituitary axis by influencing LH, TSH, CRH, oxytocin, and vasopressin secretion. GLP-2 acts from the stomach down to colon, while affecting nutrient absorption, and disposal. GLP-2 as also an intestinal-derived peptide stimulator of small bowel epithelial proliferation. Here the sequences of those two parts from glucagon:
92-128 : GLP-1 HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
146-178 : GLP-2 HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Walensky’s patent states, quote:”invention provides stably cross-linked insulionotropic polypeptides having superior and unexpected benefits in the treatment of conditions involving abnormal glucose homeostasis, e.g., type 2 diabetes and conditions relating to type 2 diabetes. Such benefits include, but are not limited to, extended polypeptide half-life, enhanced alpha-helicity, improved thermal stability and protease resistance, increased functional activity and pharmacologic properties, improved bioavailability when administered by any route”
The difference between NovoNordisk patent and the entire GLP-1 length is the ‘HDEFER’ sequence which was left out in Ozempic. NovoNordisk has also patents for the GLP-2 related peptides, which overlap with Spike in that important ‘KRSFIEDLLFNKV’section, all summarized below:
HADGSFSDEMNTILDNLAARDFINWLIQTKITD Novo Nordisk Patent/NPS Pharmaceuticals,
HADGSFSDEMNTILDNLAARDFINWLIQTKITD GLP-2 /2L63
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG HUMAN Semaglutide peptide 7KI0
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG 4ZGM GLP_1
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG => GLP_1 NATURAL P01275
and this is BLAST alignment of the GLP-2 (ONLY 33 AA’s) with Spike2020:
Query 18 AARDFINWLIQTKIT 32 GLP-2
+ R FI L+ K+T
Sbjct 813 SKRSFIEDLLFNKVT 827 Spike2020
Query 14 LDNLAARDFI 23
L ++AARD I
Sbjct 841 LGDIAARDLI 850
Query 5 SFSDEMN 11
SF +E++
Sbjct 1147 SFKEELD 1153
Query 16 NLAARDFI--N 24
NL R+F+ N
Sbjct 188 NL--REFVFKN 196
Query 20 RDFI-----NWLIQTKIT 32
R FI N K+T
Sbjct 815 RSFIEDLLFN-----KVT 827
Query 22 FINW-----------LI 27 GLP-2
+I W LI
Sbjct 1209 YIKWPWYIWLGFIAGLI 1225 <<SPike2020 part related to HIV!!!!
diff parameters:
Query 2 ADGSFSDEMNTILDNLAARDFI 23
AD F + L ++AARD I
Sbjct 829 ADAGFIKQYGDCLGDIAARDLI 850
Query 5 SFSDEMNTILDNLAARD 21
SF +E++ N D
Sbjct 1147 SFKEELDKYFKNHTSPD 1163
Query 4 GSFSDEMNTIL---DNLAARDFINWLI 27
G S +N IL D A I+ LI
Sbjct 971 GAISSVLNDILSRLDKVEAEVQIDRLI 997
There is another insulin issue in connection with Spike. When searching the https://peptideatlas.org/builds/human/phospho/202204/APD_Hs_all.fasta for PRRAR motif, that peptide shows up ‘>PAp07149871 HDSPDPSPPRRAR‘, which is a part of https://www.ncbi.nlm.nih.gov/protein/Q9BRD0.1 s.c. human spliceosome with 3 identical PRRAR sites and couple of highly homologous to it, the same so frequent FURIN SITE, inserted also in Spike2020:
Query 145 HDTPDPSPRRAR 156 Q9BRD0.1 BUD13
+ T SPRRAR
Sbjct 674 YQTQTNSPRRAR 685 Spike2020
Query 116 NRHFRHDTPDSSPRRVRHGTPDPSPRKDR 144
N + D P + + T SPR+ R
Sbjct 657 NNSYECDIPIGAGICASYQTQTNSPRRAR 685
Query 185 SDTSPPRRAR 194
+ T+ PRRAR
Sbjct 676 TQTNSPRRAR 685
Query 228 PRRARHGSS 236
PRRAR +S
Sbjct 681 PRRARSVAS 689
that on top of many other highly relevant sections, just few :
Query 579 WPGYRWDG 586
WP Y W G
Sbjct 1212 WPWYIWLG 1219 <<HIV related section again!!!
Query 474 KLERLEQRRKAEKDSERDELYAQ 496
+L R E+D E++AQ
Sbjct 762 QLNRALTGIAVEQDKNTQEVFAQ 784
Query 55 DVSWTAISTTKLEKEEEEDDGDLPVVAEFVDERPEEVKQMEAFRSSAKW 103
D+S S ++KE + L VA+ ++E +++++ + KW
Sbjct 1168 DISGINASVVNIQKEIDR----LNEVAKNLNESLIDLQELGKYEQYIKW 1212
This BUD13 protein splicing RNA, affects the s.c intron retention while regulating gene expression. Deficiency in BUD13 dampens the interferon 1 response, as result of which macrophages can’t withstand vesicular stomatitis virus (VSV) infection (https://www.cell.com/molecular-cell/fulltext/S1097-2765(18)31030-X and https://pubmed.ncbi.nlm.nih.gov/30639243/). Only recently it was discovered that RNA splicing affects also insulin regulation (https://news.feinberg.northwestern.edu/2020/07/02/new-role-for-rna-splicing-in-insulin-regulation/) via the s.c. clock gene (https://www.genecards.org/cgi-bin/carddisp.pl?gene=CLOCK), playing a central role in the regulation of circadian rhythms. That possibly ties with the developing embryo, without too much light, and the bifidos playing the central role in this process… The clock stands for ‘Circadian Locomotor Output Cycles Kaput’, and it is very strange that ‘they’ put that word Kaput in this name, which means ‘damaged’ in German…
This clock protein (mouse https://www.uniprot.org/uniprotkb/O08785/entry and human form at https://www.uniprot.org/uniprotkb/O15516/entry) has incredible functions, from rhythms in metabolism and behavior to sleep, body temperature, blood pressure, endocrine, immune, cardiovascular, and renal function. Basically the energy derived from the Krebs cycle of every cell, is divided into all actions, depending on LIGHT, which implies timing during the day/night! Isn’t that the MELTONIN effect on covid related issues???
And it also plays an essential role in cancer: https://www.nature.com/articles/s12276-021-00681-0 . It appears that melatonin promotes adipocyte proliferation by forming a Clock/HDAC3/c-Myc complex and subsequently drives the circadian amplitudes of proliferation genes (https://pubmed.ncbi.nlm.nih.gov/27987529/). The c-MYC cancer connection needs to be kept in mind, for later.
To close this medley, one mention about the NIH project titled: All of Us, after ~9 years of research, which was to collect genetic and health data from one million volunteers…, changes.
Research Program (previously known as the Precision Medicine Initiative Cohort Program[1]) is a research program created in 2015 during the tenure of Barack Obama with $130 million in funding that aims to make advances in tailoring medical care to the individual. And now the news from today 10/16/2024:
“All of Us Program to Delete Genetic Ancestry, Trait, Health Info From Participant Accounts” => so suddenly no more medical care for individual???? Further:
“In an email sent to participants on Wednesday, All of Us said genetic ancestry and trait DNA results will be deleted from their accounts effective Nov. 22.
Health-related DNA test results will remain available as PDFs in an updated system beginning in January of next year, but only if participants log on to view them before Nov. 22. The PDFs, too, will be deleted from participants' accounts at the end of 2025.“
Also, quote (https://www.genomeweb.com/research-funding/all-us-program-delete-genetic-ancestry-trait-health-info-participant-accounts):
“"We know these are big changes to how we share DNA results," the organization wrote in its email to participants. "As a research program, we are always learning and growing. We do our best to listen to our participant partners and adapt to changes in our program. Despite these changes, our vision remains the same: to drive discoveries that lead to better health and provide you with information that matters to you."“
What do ‘they’ know what we don’t AFTER the introduction of the genetically modifying covid injections, which btw, do ‘not work’ at all (https://www.science.org/content/article/missing-immune-cells-may-explain-why-covid-19-vaccine-protection-quickly-wanes)??
LAST note about another INSULIN offender:
And the promised Dr. Levy’s Protocoll, which he kindly provided to everyone:
++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++
Persistent Spike Protein (PSP) Protocol
Thomas E. Levy, MD, JD
January 31, 2024
The protocols for PSP syndrome (Long-Haul COVID and/or post-COVID vaccine syndrome) are similar for both prevention and resolution, differing primarily in dosing and clinical aggressiveness in the application.
For PSP Prevention and Health Optimization
Super 8 supplementation
[To reduce increased intracellular oxidative stress and optimize intracellular vitamin C levels]:
Vitamin C, 3,000 to 9,000 mg daily
Magnesium chloride, 1,000 to 3,000 mg daily
Vitamin D3, 3,000 to 10,000 international units daily
Vitamin K2, 500 micrograms daily
[To optimize mitochondrial production of ATP]:
Niacinamide 1,000 to 3,000 mg daily
Riboflavin 400 mg daily
Coenzyme Q10, 600 to 900 mg daily
Methylene blue, 25 mg daily
Above supplements are virtually non-toxic, and dosages can be adjusted up (or down) as desired and depending on how well one feels.
For chronic PSP syndrome
Super 8 supplementation, and, depending on availability to the patient:
Any of the bio-oxidative therapies, singly or combined (available at Riordan Clinic, Wichita, KS):
• Vitamin C, 25 to 100 gram infusions (with 25 to 50 mg of hydrocortisone if possible)
• Hydrogen peroxide infusions (0.15% concentration in D5W)
• Ozone autohemotherapy; EBOO (extracorporeal blood oxygenation and ozonation) if possible
• Ultraviolet blood irradiation
• Hyperbaric oxygen therapy (1.5 to 2.0 atmosphere pressures)
Hydrogen peroxide nebulization (3% or less, depending on patient tolerance)
15 minutes daily until clinical resolution
EDTA chelation (CalciumDisodium EDTA) intravenously or a quality oral EDTA supplement, as directed by the treating medical professional
Ivermectin 3 to 6 mg daily and zinc picolinate 50 mg daily
Nattokinase 200 to 400 mg twice daily
D-dimer testing is essential for the optimal clinical management of the patient. It should be 500ng/cc or less. Higher levels indicate increased blood clotting in the body, caused by the persistent attack of the spike protein on blood vessel receptors. Clinical resolution cannot be considered complete as long as this blood test remains elevated.
Many high-quality nutrient supplements can be taken as well. However, these recommendations are advanced as critical baseline components of an effective anti-spike protein regimen. The importance of these specific recommendations, along with their scientific validation, can be found in the resources listed below.
Hydrogen Peroxide Nebulization
and
https://www.rvr.medfoxpub.com/ (complimentary book)
Ultraviolet Blood Irradiation and D-dimer testing
and
https://riordanclinic.org/2023/11/ultraviolet-blood-irradiation-new-hope-for-chronic-covid/
Bio-oxidative Therapies
https://www.tomlevymd.com/articles/omns20230310/Resolving-Persistent-Spike-Protein-Syndrome
Methylene Blue
EDTA, heavy metal toxicity, and Super 8 Supplementation
Vitamin C synergy with Cortisol (hydrocortisone)
If there is anyone still reading, THANK YOU for SO MUCH patience:)))))))
Wish you a MERRY CHRISTMAS one more time, since you read to this point, with 3 hours of nice music, no classic this time…
or wait, can’t do without it:
THE END
Literature:
https://thedermreview.com/gundry-md-polyphenol-dark-spot-diminisher-review/
https://www.nutritionadvance.com/nutrition/top-food-sources-polyphenols/
https://www.lifeextension.com/magazine/2015/6/protect-your-skin-from-age-related-glycation
https://www.sciencedirect.com/science/article/pii/S102194981630179X
Reliably brilliant.
Way, way too brilliant for the likes of me.
Have you seen this old study by Dr. Nora Volkow, Trotsky's great granddaughter? No food needed. Dr. Jack Kruse has often referred to her.
\\https://pubmed.ncbi.nlm.nih.gov/21343580/
Effects of cell phone radiofrequency signal exposure on brain glucose metabolism
EXCERPT "In healthy participants and compared with no exposure, 50-minute cell phone exposure was associated with increased brain glucose metabolism in the region closest to the antenna."
Happy New Year!
Thank you so much for this wonderful post and the videos. Happy New Year!!