Evolutionary Dynamics: brought to you by Jeffrey Epstein, with connections to SAR-CoV-2 Spike genetically modifying injections.
4/10/2026: How Palantir with its Foundry now monitors the genetic modifications of ‘covid pandemic’: https://blog.palantir.com/leveraging-palantir-foundry-to-monitor-genetic-mutations-of-covid-19-56a2392d26d2 . From interview titled “Moderating Human Behavior: Palantir Insider REVEALS Company’s Sick Plans for A.I.“ at https://www.brighteon.com/ec89c4c6-e6c1-42e2-b196-e5ab7c59b3eb ( Alex Karp at 4:56)
2/18/2026: the final goal for Epstein and his entire clan was, and as long as nobody is arrested, still is 'the s.c. ‘digital health’ (https://www.justice.gov/epstein/files/DataSet%2011/EFTA02658424.pdf and more at the end) with ‘great scientists’ names like: Nandan Nilekan (and team/Aadhaar), Geoff Ling (DARPA), Paul Greengard (Nobel Laureate, Rockefeller), Linda Buck (Nobel Laureate, Fred Hutchison Cancer Center), Yann LeCun (convolutional nets, Facebook), Todd Park (former CTO of the USA), including WEF Global Future Council on Blockchain, WEF Global Future Council on Neurotechnology and Brain Science, with Lauder Foundation, Mayo Clinic, Kaiser Permanente, Stanford (Shenoy Lab), Caltech (Koch Lab).
2/11/2026: How ‘american’s’ of Russian origin who influence MIT science are connected with Epstein, with 3 links here and rest at the end of this post: from 2010 https://www.justice.gov/epstein/files/DataSet%2011/EFTA02422408.pdf , from 2014 https://www.justice.gov/epstein/files/DataSet%2011/EFTA02421173.pdf and https://www.justice.gov/epstein/files/DataSet%209/EFTA00284908.pdf
2/9/2026: 2015 Epstein’s email about cancer in https://www.justice.gov/epstein/files/DataSet%209/EFTA00710399.pdf and direct involvement of its subject in SARS-CoV-2 https://www.nature.com/articles/s41392-023-01719-7 Great summary of many Epstein files by Prof. Homburg attached at the end of this post. The top ‘science magazine’ Nature publishes https://www.nature.com/articles/d41586-026-00388-0 paper with ‘list of nearly 30 top scientists,‘ in connection with Epstein, among them many completely unknown, yet the biggest names like Craig VENTER and others, completely ‘forgotten’. How strange!
2/5/2026: Jason Powers, a substack writer uncovers the genetics obsession in Epstein files, link to his newest post is added at the end. Also some of the Epstein files related to RNA, cloning, genetic experimentation, including involvement in Pfizer FINANCING, briefing into CRISP technologies by Deutsche Bank are also listed at the end of this post.
1/31/2026: Important link at the end to an interview of Bannon with Epstein, who was placed on the board of the Rockefeller Foundation to ‘manage’ the finances within the interdisciplinary sciences, thanks to a good friend, David Rockefeller (https://www.justice.gov/epstein/files/DataSet%209/EFTA00584942.pdf *). It’s also about Rothschilds..
12/12/2025 IMPORTANT. A must read by everyone who wants to understand this post. It is a 2012 hearing about economic planning of Virgin Islands with Jeffrey Epstein revealing his monumental money making idea using HUMAN GENES: https://www.documentcloud.org/documents/23858163-virgin-islands-economic-development-hearing-2012-govuscourtsnysd59165318640/
added some changes at the very end, and more updates. It is a pity, that this ‘special’ post, caused some readers unsubscribing. On 8/5 I’m changing the front image of the post to 2017 National Geographic cover titled ‘The Next Human’, which features an article citing Prof. George Church from MIT (whose work is related to Epstein’s money). His EXTREMELY IMPORTANT statements expressed in that NG edition are copied and questioned, below in text. Here a statement from Epstein files: “The genetic manipulation of wild populations has been discussed as a solution to a number of humanity’s most pressing ecological and public health concerns, including the eradication of insect-borne diseases such as malaria, the reversal of herbicide and pesticide resistance in agriculture, and the control of destructive invasive species“ (https://www.justice.gov/epstein/files/DataSet%209/EFTA01205594.pdf) . The same LIES of the scientific criminals as always.
: also a new post, an extensive summary by Strange Sounds Substack about Palantir and Epstein is added below.
Is the title connected with the delay of the finally showed up files everyone would like to see? Don’t know, but this below, shall we know. After very long break (am very sorry!) this finally next post, will be a short one, touching two topics, the 5 years long still ongoing story of the Sars-CoV-2 and its Spike genome, story never even remotely touched by the new administration (similar to JE files..), story connected to military operations (similar to JE files..), and the most recent debate about the lost/changed files of the national importance, discussed by many, among others by a journalist Jon Rappoport in his post at:
With one word, is there a connection between covid related issues, including the Pfizer and MOD-e-RNA covid GENE therapies and J. Epstein who had some friends among top geneticists out there?? Rappoport points to a summary at https://www.prnewswire.com/news-releases/jeffrey-epstein-science-financier-changes-the-course-of-evolution-at-harvard-211218581.html, with a quote:
NEW YORK, June 12, 2013 /PRNewswire/ -- Ten years ago the Program for Evolutionary Dynamics was founded at Harvard with a $30 million dollar grant from a financier called Jeffrey Epstein. Since then, the Program, under the direction of Martin Nowak, a professor of Mathematics and Biology at Harvard (https://ped.fas.harvard.edu/files/ped/files/nowakcv_jan2017.pdf), a Wellcome Trust Senior Research Fellow 1992-1998, has changed the way in which evolution is studied and utilized.
This old article points to the 22 years old establishment of digital genetics (linear sequences of given numbers of nucleotides), based on mathematics. The program dealt first with viral infection models, based on small amount of genetic material, with conditions leading to destabilization of chromosomes, and ever since ~2002 (timeline of SARS-CoV), it ended up with more investigations of cancer.
“In 2012 for example, the Program developed the first mathematical model of how colon cancer cells become immune to inhibitor therapy. The research showed how the KRAS gene is not activated from inhibitor drugs, making cells resistant, but rather a small percentage of cancer cells with an inherantly activated KRAS gene are immune from the start and evolve to predominance as other cancer cells are destroyed by the inhibitor drug. The discovery was critical because instead of applying drugs in sequence to fight resistance, using a cocktail of inhibitor drugs to capture both activated KRAS gene cells and those without, came into focus. In 2010, the Program published a study showing that most solid tumors contain 40 to 100 genetic mutations, but on average only 5 to 15 actually drive tumor growth. The findings highlighted the importance of targeting only a minority of tumor cells for effective inhibitor treatment.“ This one image shows which genes are KRAS dependent, and those who know SARS-CoV-2 Spike, recognize some of them here (copied from https://www.mdpi.com/2072-6694/15/6/1635):
Harvard open statements about Epstein’s funding money at: https://ogc.harvard.edu/files/ogc/files/report_concerning_jeffrey_e._epsteins_connections_to_harvard_university.pdf
do not mention any scientific details, page which in 2026 disappeared! The recently released Epstein files clarify better that topic, for example in: https://www.justice.gov/epstein/files/DataSet%209/EFTA01116320.pdf . The name of Prof. Martin Nowak (evolutionary theory and viral dynamics), in the now disappeared Harvard files, appears in it 123 times, and the big, so important name (in covid ‘times’) of Prof. George Church, collaborating with Nowak, 15 times.
The money expert Epstein was tortured with the very same scientific interests as the father of his girlfriend Ghislaine, Mr. Ian Robert Maxwell, born in Ukraine, the ‘chameleon of all names’, also known as John Ludvik, or Ján Ludvík Hyman Binyamin Hoch or Ivan du Maurier or Leslie du Maurier as Candace found out at https://candaceowens.com/video/the-epstein-files-dead-men-tell-no-tales-an-introduction/). Some of Maxwells family history connecting to Epstein can be found at: https://rumble.com/v6ws7ny-house-of-maxwell.html?mref=5grgb&mrefc=5 and his power in the area of scientific publishing: https://docs.lib.purdue.edu/cgi/viewcontent.cgi?article=8480&context=atg further goes into Welcome Trust business: https://rogue-scholar.org/records/ystd4-npt46 .
"Mathematics in evolutionary biology is an exciting new field," Jeffrey Epstein remarked, whose foundation supports cutting edge science across the United States. "It reveals patterns that are otherwise hard to detect."
Yes, that must be it, his one and only Little Saint James, U.S. Virgin Islands must have been behind the scientific goal of all the rich men, and poor girls, placed on Lolita Express heading towards the beaches in order to go down the rabbit hole of mathematics in human genes expression…. Here some of the citations of Prof. M. Nowak papers (https://www.martinnowak.com/publications) related to the RNA based theory of evolution (is that why one and the same mod mRNA SPike genome for the entire world?), and how to influence it:
”Using an analysis based on game theory, we can predict the situations in which cooperation, selfishness, or a mixture of the two is beneficial to the future evolutionary success of RNAs.” or “The dynamics of RNA assembly in a complex mixture of sequences is a frequency-dependent process and mimics such scenarios.“ or “In some cases, we find that mixtures of different RNAs reproduce much better than each RNA type alone, reflecting a molecular form of reciprocal cooperation.“, from https://www.pnas.org/doi/full/10.1073/pnas.1525273113 titled “Dynamics of prebiotic RNA reproduction illuminated by chemical game theory“
“The question of how complexity and cellular life arose on early earth remains unanswered. As we discussed in the introduction, prominent experimentalists within the field have over the years attempted to make efficient RNA polymerases [8, 9, 20, 70]. The premise behind this approach is that once there is an RNA replicase, it will kickstart Darwinian evolution and hence allow for mutations and natural selection to generate complexity in the familiar way.“ The severity of this statement is currently full in heinous action, that’s the SELF-replicating mod mRNA injections containing RNA-dependent RNA polymerase obtained from a Venezuelan equine encephalitis virus, currently injected into pets since summer 2024:
“These include previously unrecognized putative cancer drivers (RPS15, IKZF3), and collectively identify RNA processing and export, MYC activity, and MAPK signalling as central pathways involved in CLL.“ at https://pubmed.ncbi.nlm.nih.gov/26466571/ titled “Mutations driving CLL and their evolution in progression and relapse“ where CLL stands for chronic lymphocytic leukaemia.
“While other genetic polymers may have preceded RNA, it is generally accepted that an “RNA world” evolved at some point. In this world, RNA acted as both information carrier and enzyme (Woese, 1967; Crick, 1968; Orgel, 1986; Joyce, 1989, 2002; Ellington and Szostak, 1990; Cech, 1993; Sievers and von Kiedrowski, 1994; Johnston et al., 2001; Steitz and Moore, 2003; Hughes et al., 2004). Evidence supporting the RNA world theory comes from several sources, including the
discovery that RNA forms the catalytic core of the ribosome (Nissen et al., 2000) and the discovery of RNA molecules that catalyze nucleic acid chemistry (Wilson and Szostak, 1999). A particularly noteworthy RNA molecule, evolved from a ligase ribozyme, catalyzes template-directed RNA polymerization, demonstrating a step toward a replication enzyme (Bartel and Szostak, 1993; Johnston et al., 2001). In a recent experiment, Lincoln and Joyce (2009) constructed paired RNA catalysts that can synthesize copies of each other when supplied with the right chemical precursors.“ from https://pmc.ncbi.nlm.nih.gov/articles/PMC2827768/pdf/nihms170295.pdf Please note, the RNA ‘origin’ story develops ~50 years AFTER DNA discovery and it central role in reproduction.
one of many emails between Nowak and Epstein: https://www.justice.gov/epstein/files/DataSet%209/EFTA00714285.pdf and one at https://www.justice.gov/epstein/files/DataSet%209/EFTA01187403.pdf pointing to “Genome-Wide RNA Polymerase II Profiles and RNA Accumulation Reveal Kinetics of Transcription and Associated Epigenetic Changes During Diurnal Cycles.”
Almost every gene mentioned in 3. is connected with SARS-CoV-2 activity. Who would thought that behind so much in depth theories there is this dirty Epstein’s money, as the very cause of these investigations? Prof. G. Church and M.A. Nowak in 2017 published together an article titled: ”Evolutionary dynamics of CRISPR gene drives” (https://www.science.org/doi/10.1126/sciadv.1601964), which should explain everything what happened ever since 2020. Just one quote from it:”The alteration of wild populations has been discussed as a solution to a number of humanity’s most pressing ecological and public health concerns. Enabled by the recent revolution in genome editing, clustered regularly interspaced short palindromic repeats (CRISPR) gene drives—selfish genetic elements that can spread through populations even if they confer no advantage to their host organism—are rapidly emerging as the most promising approach.” Also the mentioned edition of NG that year published Church’s statements, quote: “People get hang up on Darwin and DNA but most of the selection today is occurring in culture and language, computers and clothing. In the old days, in the DNA days, if you had a pretty cool mutation, it might spread in the human race in a hundred thousand years. Today if you have a new cell phone or transformative manufacturing process, it could spread in a week“!!!!! He is talking about synthetic genes from a ‘transformative process’, I do believe. Indeed, after the covid genes introduction via the nanos in the shots, starting from already the clinical trials, the covid spread was pretty fast! But he knew more, something about Iphones…. Oh, did you have a hair loss after the covid infection (shedding) or injection? Or eyes issues? Or hearing issues with strange features in which a digital sound becomes way more prevalent than analog, like the one from your own family members?? Try to go to VAERS and search for hearing issues, you will have NO digital rights to see the result!!!! Well, that NG 2017 image, has it all.
If it is still not clear, here a quote from recent paper clarifies the essence of Prof. Nowak’s work: “Here we engineered an orthogonal alphaviral RNA replication system to evolve RNA-based devices, enabling RNA replicase-assisted continuous evolution (REPLACE) in proliferating mammalian cells. This system generates a large, continuously diversified library of replicative RNAs through replicase-limited mode of replication and inducible mutagenesis.“ and also “Collectively, this work establishes a powerful platform for advancing mammalian synthetic biology and cell engineering applications through directed evolution.“ in https://www.nature.com/articles/s41589-024-01783-2 .
Nowaks’ KRAS gene is worth to look into, despite of some chinese scientists writing about it in 2024, quote: “For decades, KRAS has always been a huge challenge to the field of drug discovery for its significance in cancer progression as well as its difficulties in being targeted as an “undruggable” protein. KRAS regulates downstream signaling pathways through protein–protein interactions, whereas many interaction partners of KRAS remain unknown.“(https://pmc.ncbi.nlm.nih.gov/articles/PMC11575137/). Despite of this, the uniprot entry about KRAS is very extensive: https://www.uniprot.org/uniprotkb/P01116/entry . As usual, let’s look at few NIH BLAST outputs comparing SARS-CoV-2 Spike with KRAS, a GTPase of the following catalytic activity: ( GTP + H2O ) = ( GDP + phosphate + H+ ) with its switch I, motif ‘YDPTIEDSY’ binding effector proteins, depending on catalytic activity (Query line represents KRAS amino acide sequence, Sbjct the Spike2020):
the below alignment is not perfect, it BUT covers ~1/3 of total KRAS length
Query 76 EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLAR 135
EGF C F + + F+ + Q RV +VL P+ K++ +L +
Sbjct 484 EGFNCYFPL-QSYGFQPTNGVGYQPYRV-------VVLSFELLHAPATVCGPKKSTNLVK 535
Query 136 SYGIPF 141 <<KRAS
+ + F <<IDENTITIES
Sbjct 536 NKCVNF 541 <<Spike2020
Query 88 KSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLP 121
++F + + V + DV + +V N P
Sbjct 1107 RNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDP 1140
the effector region 'YDPTIEDSY' is only covered by BLAST the following way:
Query 26 NHFVDEYDPTIEDSYRKQVV---IDG 48 <<KRAS
+ F +E D ++ V I G
Sbjct 1146 DSFKEELDKYFKNHTSPDVDLGDISG 1171 <<Spike2020
a search 'by hand', gives two more possibilities, almost 100 identical:
Query 26 NHFVDEYDP-TIE-DSYRKQVVIDGET 50 <<KRAS
IDENTITIES YDP E DS++ ++
Sbjct IVNNTVYDPLQPELDSFKEELDKYFKN 1140 <<Spike2020
few more, with less homology, but still:
Query 27 HFVDEYDPTIEDSY--RKQVVIDG <<KRAS
+F DE +DS K V +
Sbjct 1146 KF-DE-----DDSEPVLKGVKLHY <<Spike2020
Query 35 FV---DEYDPTIEDSYRKQVVIDG--ET-CLLD 40 <<KRAS
F+ +E ++TI D+ + D+ ET C L
Sbjct 284 FLLKYNE-NGTITDAVDCAL--DPLSETKCTLK 289 <<Spike2020
even the P-loop, binding the nucleotide has some homolog sections:
GAGGVGKS <<KRAS
GAG + S
GAG-ICAS <<Spike2020there are many more homologous fragments for this 188 residues long protein, related to cancers, growth stimulation, proliferation and survival, all energy dependent. A good structural overview of KRAS is at https://pmc.ncbi.nlm.nih.gov/articles/PMC6965201/ . One needs to keep in mind that if the KRAS substrate, ‘energy’ molecule GTP, is required for RNA synthesis, which then can drive cancer progression, every single step of which is energy driven, then how on earth the sudden appearance of the in muscle injected synthetic spike mod mRNA gene requiring 3x1273 more energy molecules, genetically not coordinated with any other living process in form of DNA gene corresponding with that RNA in the time of the injection, suppose to stay unnoticed? It won’t, here just one publication talking about this: https://www.preprints.org/manuscript/202507.2155/v1 titled “Synthetic mRNA Vaccines and Transcriptomic Dysregulation: Evidence from New-Onset Adverse Events and Cancers Post-Vaccination”. It would be a good example, if it was not for the false title with the deceptive usage of the word ‘vaccines’…
There is also another disturbing common issue around KRAS and the Spike genome:
“Insight into the Complexity of the i-Motif and G-Quadruplex DNA Structures Formed in the KRAS Promoter and Subsequent Drug-Induced Gene Repression” at https://pubs.acs.org/doi/10.1021/jacs.7b02046
which sounds like we have something similar here: “Potential G-quadruplexes and i-Motifs in the SARS-CoV-2” at https://pubmed.ncbi.nlm.nih.gov/34101725/
That, at the end leads to prions, according to Dr. Seneff and others:
and https://stephanieseneff.net/wp-content/uploads/2025/02/Seneff_Corona_2022.pdf
citing the “Innate immune suppression by SARS-CoV-2 mRNA vaccinations: The role of G-quadruplexes, exosomes, and MicroRNAs” at https://pmc.ncbi.nlm.nih.gov/articles/PMC9012513/
Finally “The regulation and functions of DNA and RNA G-quadruplexes” (https://pmc.ncbi.nlm.nih.gov/articles/PMC7115845/pdf/EMS86249.pdf ) illustrates how important these features are.
The viral work of Prof. Nowak involved mainly HIV-1, where he collaborated in 90-ies with the ‘covid hero’ Dr. A. Fauci, involving experiments quantifying the RNA amounts during infections for vaccines development, or maximizing virus production in the face of rapid killing of infected target cells, or measuring in plasma HIV RNA while testing different drugs (why didn’t ‘they’ measure the RNA inside of HUMANS before and AFTER covid injections, that’s a BIG QUESTION!!!). Funding for these works, already in those times, came also from the very same Welcome Trust, playing essential role in covid19 drugs and vaccines development:
T-W. Chun, .., M. A. Nowak & A. S. Fauci (1997). “Presence of an inducible HIV-1 latent reservoir during highly active antiretroviral therapy.” Proc. Natl. Acad. Sci. USA 94: 13193-13197.
J. D. Lifson, M. A. Nowak, .., A. S. Fauci & V. M. Hirsch “The extent of early viral replication is a critical determinant of the natural history of simian immunodeficiency virus infection.” J. Virol. , Dec. 1997, p. 9508–9514
M. A. Nowak,, .., A. S. Fauci, V. M. Hirsch & J. D. Lifson (1997). Viral dynamics of primary viremia and antiretroviral therapy in simian immunodeficiency virus infection. J. Virol. 71: 7518-7525.
Some of his paper scripts at that time were reviewed by Drew Weissman, the 2023 Nobel Prize winner so greatly prized for his mod mRNA work which finalized in universal covid Spike gene therapies applied on the entire world population, without consent, thus illegally.. In 2015 article titled “mRNA: Fulfilling the Promise of Gene Therapy” at https://www.cell.com/molecular-therapy-family/molecular-therapy/fulltext/S1525-0016(16)30267-2 was published by Drew Weissman1 dreww@upenn.edu ∙ Katalin Karikó2 katalin.kariko@biontech.de , the very same scientists, who completely decimated innate immunity via introduction of foreign genetic material into human bodies, across the entire world, now, after 2020, the same people changed their language and only talk about: “therapeutics and vaccines—a realization crucial to the rapid development of the life-saving mRNA COVID-19 vaccines during the deadly pandemic.:” No more ‘mRNA gene therapy’ in 2020, with the synthetic version of mRNA, properly called mod mRNA, as if the word ‘GENE THERAPY’ got suddenly after 2020 highly classified, in the very same time of its application by the MD’s and ‘science priests’ around the globe. That classification of the ‘therapy’ itself, is not the only issue, the families of the people dying after the injections, have the right to know the bitter truth of the ‘white clots’ being pulled from blood vessels by many surgeons, and certainly by MANY embalmers who are trying to raise the alarm, and are being SILENCED, even by the ‘most friendly truth telling media’:
H. Clifford Lane also appears in Nowak’s papers, Fauci’s best body… Around 2002 the interests of Prof. Nowak shifted from viral related issues and genetic chromosomal instabilities more towards cancer research. His membership in the ‘prestigious’ EDGE club (https://www.edge.org/memberbio/martin_nowak) with countless other top scientists (https://www.edge.org/people) and artists, for example https://www.edge.org/memberbio/marina_abramovic, means basically common interests in the fields of genetics (CRISP hero https://www.edge.org/memberbio/jennifer_a_doudna), physics, mathematics, psychology, ‘art’, if one dares to call it this way in this case:
History and military are equally represented by the EDGE club. Here https://www.edge.org/memberbio/yuval_noah_harari takes the lead, for whom we humans, are ‘hackable animals’! It is the deepest irony that this monster teaches at the Hebrew University of Jerusalem, in such a special place. Given the interests of Prof. Nowak which were condensed around darwinian evolution, one special publication needs more attention. It’s title “Primordial sex facilitates the emergence of evolution“ and location: https://pmc.ncbi.nlm.nih.gov/articles/PMC5832742/pdf/rsif20180003.pdf . The meaning of sex, according to Nowak is basically information, quote:” In biology, sharing information content between two individuals is considered a defining property of sex. The implications of this information-sharing ability among protocells, which is a form of ‘primordial sex’, have not received much attention”. Protocell is a self-organized, endogenously ordered, spherical collection of lipids proposed as a rudimentary precursor to cells during the origin of life. Excuse me??? Did anyone see the nanolipid spheres injected into billions of arms??? According to this definition, people were injected with protocells, the new origin of life, premordial sex!!! Here one publication specifying the definition https://pmc.ncbi.nlm.nih.gov/articles/PMC2649781/ title “Porous Nanoparticle Supported Lipid Bilayers (Protocells) as Delivery Vehicles“ or another one, more fundamental, explaining the basics and how important it is in RNA based world THEORY: https://biologyinsights.com/what-are-protocells-and-why-are-they-important/ with a quote: “Protocells are also connected to the RNA World Hypothesis regarding the origin of life.”
Did anyone notice that we live in REALITY which was PROCEEDED BY CREATION hence now ’we the people’/the planet, and NOT some kind of THEORY our bodies need to give a proof of by genetically modifying injections?? Our bodies, so far, run physically FORWARDs in time, NOT backwards, in my view.
This conformation of Dr. David Martins preaching in covid times, presented here, needs more attention, in particular because people are coming out with even more terrifying news:
please listen starting at ~13:00. This amount of personal precision would need to have connections with Palantir, being essential in those times, alone because of collecting ALL personal data (if PCR tests, then equally peoples genomes) in regard to who, where and when got ‘the shot’: https://www.palantir.com/newsroom/press-releases/cdc-partners-with-palantir-to-bolster-the-fight-against-covid-19/ Another quote from 2021 Palantir’s pages: “Palantir was commissioned in mid-2020 by the Department of Health and Human Services to build Tiberius, a software platform it uses to track vaccine production, distribution, and administration across the United States.“ Thus it is Palantir/Thiel+Karp who know who got genetically modified and who not, and that includes the ‘special batches’ for those who were wiped out with higher probability. The question is, were the batches pre- or postdetermined.., i.e. were they preplanned for specific populations? Looks like Epstein contributed to some extend to this ‘outcome’, which once again, is terrifying:
Thus it is maybe no wonder to see in 2014 on Forbes such a subtitle:”Peter Thiel Appeared To Meet With Jeffrey Epstein, Report Says—Latest Billionaire With Epstein Ties”. Now the current big AI era will ‘live from these data’, the only problem is, there is not enough energy to run the zillions of computer centers. Tons of new material on Palantir was posted today (8/6/25) at:
and another one on 9/5/2025 from Patrick:
Oh, last serious question, to those sexually exploited, mutilated, hurt, humiliated, who never come out with their stories because of shame, what would you prefer if you never got affected, to go over the torture and have a chance of healing afterwards and slapping the face of the felon with a smile of FORGIVENESS, or to be genetically modified in your entire body, including the HEART AND THE BRAIN, and loose your identity for good, with no chance of even remotely to forgive?? This question about bodily assault, excludes children (different type of torture includes hunger with an example: https://old.bitchute.com/video/HQQMpKRO2QtJ/ ), because in such cases, there should be NO forgiveness, just my own opinion.
Update: 8/13/2025
A new Documentary is available for those who want more details on historical facts about covid genetically modifying injections, with specific emphasis on the horrific stories of the injured. The title, unfortunately deceiving (because not touching the word gene therapies, only towards the end we start to get the most important message): “Inside mRNA Vaccines“
https://www.brighteon.com/9f6c7ade-7af6-41e8-a0b6-55a72b6add21
And there is more about the key figure who keeps all the genetic data on it all:
https://old.bitchute.com/video/wd4dVc2R6C5m/
and that little section of the SARS-CoV-2 Spike genetic code encoding this amino acid string:
G-W-T-A-GAAAYY (in https://www.ncbi.nlm.nih.gov/protein/YP_009724390.1)now ‘engraved’ in who knows how many human genomes:
with questions on the final application of all these data:
According to Whitney Webb, in the age of Palantir, you do not need Jeffrey Epstein, all the smart data are here already, in the clouds available in seconds: https://www.brighteon.com/da4ab06c-f763-4996-94fe-ff11d60d29ed , thus one could end the worst crimes out there pretty fast, if one would like to… BUT, it does not happen, yet! WHY? Seth and Todd are discussing in depth the issue here:
From very begin of covid plandemic it was known, that the universally injected Spike genome integrates into the human genome: “Further evidence supports controversial claim that SARS-CoV-2 genes can integrate with human DNA“ (https://www.science.org/content/article/further-evidence-offered-claim-genes-pandemic-coronavirus-can-integrate-human-dna) and now HHS is so protective that all the covid PCR tests collecting the entire human genomes are apparently stored and kept in secret, or maybe sold to the pharma companies?? The ‘program’ description is at https://www.palantir.com/assets/xrfr7uokpv1b/1EE4kLUXymcHCQ68Xo2OzQ/8cbc5cc985ff4c3cddffdeb292c2967a/Emergency_Preparedness__Response__and_Recovery.pdf and an important podcast on it can be found at https://uncutnews.ch/corbett-interview-schockiert-palantir-nutzte-ki-um-buerger-nach-ethnie-und-gehorsam-zu-sortieren/ .
Update 9/29/2025: a new check of my own post indicates that the link to Program for Evolutionary Dynamics was CHANGED to LITERALLY laughable “https://contactanycelebrity.com/cac/contact-ghislaine-maxwell/“. Thank you a new reader who liked this post after which I noticed that change!
Update 11/7/2025 New research at https://unlimitedhangout.com/2025/11/investigative-reports/cold-harbor-eugenics-epstein-and-big-tech/ connects more dots in terms of Epstein, scientists and the future of eugenics.
Update 11/22/2025 Dr. Boris Nikolic, M.D is not only important figure related to Epstein’s will and distribution of his >500mln$ after his death, but equally to scientific works with Prof. Nowak and R. Langer, big MIT researchers: https://www.flagshippioneering.com/news/press-release/editas-medicine-raises-120-million-advance-genome-editing , essential in the new genetically mutilated human world.
Update 1/31/2026: 1/31/2026: Epstein on the board of the Rockefeller Foundation to ‘manage’ the finances within the interdisciplinary sciences, thanks to a good friend, David Rockefeller:
Update 2/5/2026:
Update 2/7/2026: One of the released Epstein files explaining Nowak’s speculations about creating biological matter without GOD, strangely coincides with Epstein pulling the plug on his involvement in Evolutionary Dynamics program: https://www.justice.gov/epstein/files/DataSet%2010/EFTA02016026.pdf
Update 2/9/2026: Prof. Homburg’s summary in German
Update 2/11/2026:
https://www.justice.gov/epstein/files/DataSet%209/EFTA00750620.pdf
https://www.justice.gov/epstein/files/DataSet%2010/EFTA02081116.pdf
https://www.justice.gov/epstein/files/DataSet%209/EFTA00701249.pdf
https://www.justice.gov/epstein/files/DataSet%2011/EFTA02418369.pdf
https://www.justice.gov/epstein/files/DataSet%209/EFTA00995604.pdf
Update 2/19/2026:
https://www.justice.gov/epstein/files/DataSet%2011/EFTA02642995.pdf
https://www.justice.gov/epstein/files/DataSet%209/EFTA01209136.pdf with a quote: “Bill Heiman has some ideas on how to create a business around this and to monetize the concepts / plant to human translational research and don’t worry he’s incredibly discrete. And discreet. Also Geoff Ling the former head of DARPA and total genius is also my good friend and very supportive - didn’t give a ton of detail but he says he will do whatever or even help run, advise, etc. he knows how to make science fiction science fact.“
https://www.justice.gov/epstein/files/DataSet%2011/EFTA02365490.pdf
https://www.justice.gov/epstein/files/DataSet%2011/EFTA02352454.pdf
https://www.justice.gov/epstein/files/DataSet%2011/EFTA02658424.pdf
https://www.justice.gov/epstein/files/DataSet%209/EFTA01029069.pdf
https://www.justice.gov/epstein/files/DataSet%2011/EFTA02365313.pdf
https://www.justice.gov/epstein/files/DataSet%209/EFTA01029072.pdf
https://www.justice.gov/epstein/files/DataSet%2011/EFTA02658658.pdf
are we talking Larry Ellison in the files below??
https://www.justice.gov/epstein/files/DataSet%2011/EFTA02658584.pdf
https://www.justice.gov/epstein/files/DataSet%2011/EFTA02365376.pdf
and the GOALKEEPER was/is(?) Obama (Brain Initiative)..:
https://www.justice.gov/epstein/files/DataSet%2010/EFTA01620719.pdf
2/22/2026: how important RNA science in 2010 was for Epstein: https://www.justice.gov/epstein/files/DataSet%209/EFTA00748238.pdf
OVER.
THANK YOU FOR BEING OUT THERE AND READING.
the Epstein file ‘dump’ is strange, has multiple version of the same similar file. In this case this one: https://www.justice.gov/epstein/files/DataSet%209/EFTA01071423.pdf
Here more of the files mentioning the BIG masters in synthetic biology, genetics, cloning, redesigning HUMANS, i.e. Craig Venter and George Church:
https://www.justice.gov/epstein/files/DataSet%209/EFTA01156115.pdf
https://www.justice.gov/epstein/files/DataSet%209/EFTA00736376.pdf
https://www.justice.gov/epstein/files/DataSet%209/EFTA00749351.pdf
https://www.justice.gov/epstein/files/DataSet%2011/EFTA02380379.pdf
https://www.justice.gov/epstein/files/DataSet%209/EFTA00734558.pdf
https://www.justice.gov/epstein/files/DataSet%209/EFTA00717710.pdf
https://www.justice.gov/epstein/files/DataSet%209/EFTA00629471.pdf
https://www.justice.gov/epstein/files/DataSet%2010/EFTA01866406.pdf
https://www.justice.gov/epstein/files/DataSet%209/EFTA00606986.pdf
https://www.justice.gov/epstein/files/DataSet%209/EFTA00583634.pdf
Pfizer was on Epstein list too: https://www.justice.gov/epstein/files/DataSet%2011/EFTA02539825.pdf and https://www.justice.gov/epstein/files/DataSet%2011/EFTA02692886.pdf and placebo effect known by Pfizer https://www.justice.gov/epstein/files/DataSet%209/EFTA00823009.pdf and autophagy https://www.justice.gov/epstein/files/DataSet%2010/EFTA02077324.pdf
https://www.justice.gov/epstein/files/DataSet%2010/EFTA02011631.pdf
CRISPR/CAS9 briefing : https://www.justice.gov/epstein/files/DataSet%2010/EFTA01462770.pdf
https://www.justice.gov/epstein/files/DataSet%2010/EFTA01447777.pdf
https://www.justice.gov/epstein/files/DataSet%2010/EFTA02011631.pdf











Don't take unsubscribers personally. Every Substack writer of worth is reporting the same thing. Judging by the comments (and some contributors) Substack seems to be evolving into a Twitter with long words.
Either that or there's monkey business....
There is so much research here, it can become a little overwhelming to some; but not to worry; those who want/enjoy/require deep dives, like myself, love to see so many references to your writings! Thank you very kindly, for including so many🌼