Update 1st of June 2022: https://www.nature.com/articles/d41586-022-01518-0
published an article “Gene therapy’s comeback: how scientists are trying to make it safer” on the 31st May 2022 with NIH Collins’ short summary:”“We are on a roll with gene therapy,” Francis Collins, acting science adviser to US President Joe Biden, told the ASGCT meeting. “But we still have thousands of diseases that have not been approached.” and one more at the end of this article.
Update 8/23/2022: https://phys.org/news/2022-08-platform-gene-medicine-delivery-easier.html
“New platform could make gene medicine delivery easier and more affordable”
with the first sentence, quote:”The success of COVID-19 vaccines is a great example of gene medicine's tremendous potential to prevent viral infections.”
The synthetic genetic material in the covid injections represents a foreign information which encodes instructions to change the metabolic profile inside of every single cell which received that genetic material, capable of being integrated into the human genome. Up to 2020, this procedure was known better under the name of gene therapy, used mainly in rare cases with cancer patients, who believed to have altered genes and thus the therapies had the purpose to ‘fix the problem’. At the end of 2020 suddenly totally healthy human beings, upon the request of authorities, started to get injected with the very same type of genetic material, just different content. That couldn’t have happened without the redefinition of the word ‘vaccine’, which now included gene alteration technology, only to become much easier ‘acceptable’ (without consent actually) by the majority of population with lesser scientific background. So what is suddenly wrong with the genes of the healthy people??? Corona viruses were out there for decades…
What do we know about the genes? Craig Venter, the first one from the left:
is a genetic researcher working for NIH/Human Genome Project (strangely originally initiated by the Department of Energy!!!!), also involved in SARS-CoV-2 Assessment of Viral Evolution Collaborating Institutions:
https://www.niaid.nih.gov/research/save-collaborating-institutions
He is also the architect of the first 100% synthetic bacterium, a topic related to the covid injection materials and mentioned only recently in this article and video: https://principia-scientific.com/vaccines-synthetic-cells-humans/
Dr. Carrie Madej’s talks frequently mention his importance in the process of rewriting the nature, our creator. Some of her presentations are on the Bitchute channel: https://www.bitchute.com/channel/jvb6P6dwrWqQ/
B. Clinton is known more for his Lewinsky affair than for his real crimes related to his Executive Order 13139— entitled Improving Health Protection of Military Personnel Participating in Particular Military Operations described in documentaries talking about as much as ~30,000 dead soldiers after the anthrax injections^4:
https://stateofthenation.co/?p=40864
and also in a shorter version at:
or for participating in genetically modifying the entire agriculture, our food supply^1!!! All illegal^2, exactly like the current genetically modifying covid19 injections, this time though, not changing plants, but rather in the final move against humanity, changing HUMAN BEINGS^3. With the masterminds behind this last step:
the details of the universal Spike gene injection had to be prepared for a very long time, with many other players, but few of the essential ones.
One of Venter’s latest patents US9718060B2 with the priority date 2012, just renewed, titled: “Digital to biological converter“ is really telling a lot, in just this one sentence, quote: ”Thus, according to the present invention biological sequence information can be digitally transmitted to a remote location and the information converted into a biological entity, for example a protein useful as a vaccine, immediately upon being received by the receiving unit and without further human intervention after preparing the system for receipt of the information. The invention is useful, for example, for rapidly responding to viral and other biological threats that are specific to a particular locale.” These biological entities represent, quote: “A “portion” of a molecule, virus, or other biological entity can be at least 10% or at least 20% or at least 30% or at least 40% or at least 50% or at least 60% or at least 70% or at least 80% or at least 90% of the native molecule or biological entity.“ That would imply an inclusion of the entire list of homolog proteins encoded by the universally injected spike, and listed in the post:
And again, that in turn could explain the hundreds of the possible symptoms, ‘side effects’ in all the recipients of the injected covid19 Spike genome. There are only few pictures in his patent, the most impressive one:
contains a sequence ‘ACGTTGCAGC’ which is inside of the NIH stored SARS-CoV-2 official genome at https://www.ncbi.nlm.nih.gov/nuccore/NC_045512.2 , starting at the position 1964 and belonging to an"endoRNAse" known also as ‘nsp15-A1 and nsp15B-NendoU’ and described in its NCBI entry as: "Nidoviral uridylate-specific endoribonuclease (NendoU) domain of coronavirus Nonstructural Protein 15”. Molecular biology always confuses a lot, giving multiple names for the same thing. Equally confusing is the fact, that SARS-CoV-2 is ssRNA virus and yet its official sequence is expressed in DNA code. A check on 12/9/2022 for the same sequence ‘ACGTTGCAGC’ in the same place https://www.ncbi.nlm.nih.gov/nuccore/NC_045512.2 ends with negative result. The nearest one can find NOW is ‘ACGTTGCA‘ at the position 19464. It must have been my mistake..Strangely new BLAST search is not coming up with anything matching the very same sequence.
Back to Venter. One of Venter’s early interviews, is so important, that I’ll copy and paste some of that story here, just in case it ‘disappears’, like many other important documents do.
The original text is available at:
https://www.expandingawarenessrelations.com/craig-venter-of-the-nih-and-human-genome-creating-synthetic-life-trying-to-design-what-we-want-biology-to-do/
I’ll take just the most important pieces. It is about:
“operating system”
“all the characteristics of the first species disappear”
“new species emerges from this software”
“making the flu vaccine each year by using these new synthetic techniques”
“Well this has been about a 15 year process. It started back in 1995, when we sequenced the first two genomes in history. Including the smallest genome, that of mycoplasma genitalium. And we set out a goal to try and understand what the smallest genome you can have as an operating system, to try and understand the basic components of life.”
“In 2003 we reported making a 5,000 letter bacterial virus, 5X174, and how to error correct the pieces. So, we start with pieces of DNA coming off DNA synthesizers; they’re only about 50-80 letters long. That’s pretty much the limit of what you can make with a chemical synthesizer. So everything we make from that has to be putting these little pieces together.
It’s pretty stunning when you just replace the DNA software in the cell, and the cell instantly starts reading that new software, starts making a whole different set of proteins. And within a short while, all the characteristics of the first species disappear. And a new species emerges from this software that controls that cell going forward.
When we look at life forms we see them as sort of fixed entities. But this shows, in fact how dynamic they are. That they change from second to second. And that life is basically a result of an information process, a software process. Our genetic code is our software. And our cells are dynamically constantly reading that genetic code, making new proteins, the proteins make the other cellular components, and that’s what we see. But it’s hard to imagine how dynamic it is until we found, simply by replacing the software, it started making a whole new cell, whatever is defined by that software. So that’s, that’s a pretty important change in how we approach and think about life.
Also this is now the first time where we’ve started with information in the computer, built that software molecule, now over a million letters of genetic code, put that into a recipient cell, and have this process start where that information converted that cell into a new species. So this becomes a very powerful tool for trying to design what we want biology to do.”
Side note in that article: “As leaders of competing genome projects, Francis Collins, director of the National Human Genome Research Institute, and J. Craig Venter, president of Celera Genomics, were recognized, correctly, as the two most important players in the worldwide effort to spell out the 3 billion “letters” of the human genome–the biochemical recipe, encoded in our DNA, for manufacturing and operating a complete human being.“
There’s no natural algaes that we know that can do this at the scale it’s needed. So we’re going to have to use our synthetic genomic techniques to either heavily modify existing algaes or develop whole new ones from scratch that have all the parameters that we want. These same tools, these same processes can be used for making chemicals, for making food substances, we hope for cleaning up water.
But perhaps the most important immediate application is we’re already working at the Venter Institute and working with Novartis to try and make new vaccines very quickly; we think we can shorten the process by 99% for making the flu vaccine each year by using these new synthetic techniques. But I think it’s going to be one of those situations I tell audiences I talk to that ‘we’re entering a new era we’re limited mostly by our imaginations’.”
“Bacteria have much more simplified genetic systems. They don’t have the same complex regulation that higher organisms have. But there are a number of single cell eukaryotes.
So we’re eukaryotes because we have a nucleus, I think one of the key things we mastered with our studies, particularly since 2003, and we reported the latest results a few months ago in Science at the end of last year, is we can move chromosomes across the branches of life. So we can move from bacteria into eukaryotes, we use yeast for all these processes. We can take the chromosomes out of yeast and move them back into bacteria to create new life forms.
So a next step would be try to make a simplified eukaryote. Yeast is very key for bio-manufacturing, for ethanol production, etc. And if we can have even a more efficient yeast cell, and at the same time, try and understand all its components, I think we’ll be able to make synthetic eukaryotes. Higher animals, multi-cellular systems are, I think, projects for the much more distant future.”
Interviewer: “Actually I have a couple more questions. Just about how we distinguish between any sort of synthetically – organisms with synthetic genomes versus the natural ones?
Craig Venter: ” – we were when we first started down this process, what could be an artifact that could fool us into thinking we had created synthetic life, when in fact it was just a contaminate of the native chromosome? And, where would even a single molecule of native chromosome could fool us into thinking we had created a new cell?
So early on we started designing a process of putting watermarks in the genetic code. We did this in the first chromosome we reported two years ago, basically all of us that helped build the genetic code signed the DNA, coded our names into the chromosome.
With this genome we’ve gone a little bit further; we’ve put 4 major watermarks in. We’ve developed a new code for writing English language, other languages, with punctuation and numbers into the genetic code. In the first watermark we actually have this code that needs to be decoded for people to read the rest. We even have a website built into the genetic code that if people solve it they can let us know that they’ve been able to read it.”
“All the authors of this study over the… certainly the last decade, our names are all encoded in this first genome. And we have three quotations built in there of adding a little philosophy to the genetic code at the same time. Which I think the chance of finding any of these in a naturally occurring genome is about as close to zero as you can get. So we can absolutely prove from the genetic changes, that we’ve been built in to the design of the chromosomes that it’s unquestionably the synthetic DNA that we made, not some natural contaminant.
A containment, that’s a really critical issue, and it’s one of the most important issues to us, and one of the number one questions I get asked in all my litera- all my lectures around the globe. And when we look at molecular biology for the last several decades, we all use e. coli in the laboratory, that genes from multiple species have been put in it over the years – probably tens of millions of experiments. And there’s not been a single accident. And the reason for that is that e. coli has a chemical dependency for growing in the laboratory.
So these are things we can start to build in to the design of synthetic genomes, we can build in suicide genes so they can’t escape. And so we can use artificial amino acids. There’s a number of approaches that we’re developing and other labs are developing to guarantee absolute containment.”
“And this first proof of principle, we’ve largely copied the mycoides genome, because as a control, if we couldn’t boot up something that was already known, we could never get to the design phase. We deleted 14 genes from this genome, and made all these other genetic modifications. This cell only grows on extremely rich [media(sp?)] on the laboratory.
The only other place it goes, the mycoides genome is a minor goat pathogen that causes mastitis in goats. We think we’ve eliminated the genes associated with that, but it will not grow outside of the laboratory unless it’s deliberately injected or sprayed into a goat. So, we don’t work with goats, so we think we have pretty good containment systems in the lab.“
“There’s selectable markers that’s dependent on a specific antibiotic. So these are early attempts, I think. These containment approaches would get far more sophisticated with the next versions of what we and others do.”
Interviewer: “All right. Well, are there any final points you’d like to make before we close?”
Craig Venter: “Well, this is the first synthetic cell that’s been made and we call it synthetic because the cell is totally derived from a synthetic chromosome made from 4 bottles of chemicals on a chemical synthesizer. Starting with information in the computer.
Before we did these experiments starting back in the late 90’s, we asked for a complete bioethical review, knowing we were going into uncharted territory, trying to create new species. The review group at the University of Pennsylvania published the results in Science in 1999. Since then there’s been lots of different review processes around the world. The Sloan Foundation funded my institute, the Venter Institute, along with MIT, and a Washington think tank, to look at the security issues concerning this. That report was published and can be downloaded from JCVI.org.”
=======================================================================
Just before introduction of the genetically modifying covid injections at the end of 2020, Craig Venter Insitute published couple of extremely important papers:
“Systems Biology Methods Applied to Blood and Tissue for a Comprehensive Analysis of Immune Response to Hepatitis B Vaccine in Adults” Frontiers in Immun. Vol 11, Article 580373, Nov 2020.
“Unbiased analysis of peripheral blood mononuclear cells reveals CD4 T
cell response to RSV matrix protein” Vaccie: X 5 (2020) 100065“Protein signatures from blood plasma and urine suggest changes in vascular function and IL-12 signaling in elderly with a history of chronic diseases compared with an age-matched healthy cohort.” GeroScience (2021) 43:593–606.
“Rapid CRISPR/Cas9 Editing of Genotype IX African Swine Fever Virus Circulating in Eastern and Central Africa” Front. Genet., 30 August 2021 | https://doi.org/10.3389/fgene.2021.733674
The first article contains the complete analysis of human peripheral blood samples, lymph nodes aspirates and microbiome(nasal, oral, skin + fecal) samples as it is affected by the HepB vaccine, with complete RNA analysis. The second article equally with RNA analysis but this time for the respiratory syncytial virus infections in infants. The third publication was looking into every immune system pathway of aging processes, criteria included major cardiovascular, neurodegenerative, and chronic pulmonary diseases, diabetes, and cancers., looking again at RNA abundance. The last one describes the CRISPR/Cas9 gene editing and a cost-effective cloning system to produce recombinant African Swine Flu Virus.
What all these preparations have to do with NIH/NIAID? It is the NIH patent WO2017059241A1 for “Lentiviral protein delivery system for rna-guided genome editing”, specifically stating, quote:”The invention also is directed to a method of altering a DNA sequence in a host cell using such a system, where the host cell can be in a human and the altered DNA can be of the human β-globin gene. ” with the beta-globin being major compound of human blood. The lentivirus system is a gene transduction tool developed based on HIV-1, Dr. Fauci’s specialty, used for example in knocking out specific essential human genes like for example Solute carrier family 25member 12 (SLC25a12) affecting mitochondrial function and ATP synthesis, described in this patent^5.
The CDC/NIH/FDA illegally enforced modified synthetic mRNA injections, under the covid pretext, certainly would change that RNA analysis in 2021, the same type of which Craig Venter performed on human beings after receiving the ‘conventional’ vaccines, btw. for NIAID money. Why Venter/NIH/NIAID didn’t perform the same study for this time 100% synthetic mod mRNA material, before starting the biggest experiment in human history while injecting the synthetic genetic material into millions, a procedure which took 2 months to prepare in the face of a ‘pandemic’ at the begin of 2020? Venter’s experiments in advance of the 2020 pandemic indicate that ‘they’ knew it was all about changing of the building blocks inside of the human body AFTER starting to reprogram the body with that synthetic mod mRNA!
Will close this note with one BLAST comparison between the human beta-globin (H.B-Globin) and the SARS-CoV-02 Spike:
Query 33 LVVYRW--TQRFFESFGDLSTPDA-VMGNPKV 61 H.B-Globin
W TQR F ++T + V GN V IDENTITIES
Sbjct 1105 HTGNSWFVTQRNFYEPQIITTDNTFVSGNCDV 1128 Spike
or
Query 38 W--TQR-FFESFGDLSTPDA-VMGNPKV 61
W TQR F+E T + V GN V
Sbjct 1104 WFVTQRNFYEP-QIITTDNTFVSGNCDV 1128
whereby the short peptide (indicated above), left after the globin digestion:
LVVYPWTQRF PeptideiPRO_0000296641 33 – 42 LVV-hemorphin-7
LVVYPWT PeptideiPRO_0000424226 33 – 39 Spinorphin
has an extremely important role in the human body, quote:”We conclude that LVV-h7 modulates behavior, displays antidepressant and anxiolytic effects that are mediated in part by oxytocin receptors. (https://pubmed.ncbi.nlm.nih.gov/28985964/ )”. As always there are many more homologies in the amino acid sequences of Spike and human hemoglobin beta subunit, and every single one of them is a proof of crime performed by the CDC/FDA/NIH/NIAID and other scientists:
Query 28 ALGRL-------------LV 34 H.B.Globin
ALG+L LV Identities
Sbjct 944 ALGKLQDVVNQNAQALNTLV 963 Spike
Query 6 PEEKSAVTALWGKVNVD-EVGG 26 H.B-Globin
P++ + W N+D VGG Identities
Sbjct 426 PDDFTGCVIAWNSNNLDSKVGG 447 Spike
Query 43 FESFGDLST 51 H.B-Globin
FE D+ST Identities
Sbjct 464 FER--DIST 47 Spike (ACE2 BRD part!!!)
Query 20 NVDE-VGG 26 H.B-Globin
N+D VGG Identities
Sbjct 440 NLDSKVGG 447 Spike
Please, if you got that far, leave me a comment, or a question, correction or suggestion. The worst of all is silence. Thank you for getting that far!
1st June 2022 update: Form a nature article titled:”Gene therapy’s comeback: how scientists are trying to make it safer” a quote:
“And the US National Institutes of Health (NIH) has launched a programme to study AAV vectors, in the hope of fostering a gene-therapy pipeline in which developers can simply swap a new therapeutic gene into the viral genome to treat a particular disease, without having to conduct large clinical trials to establish safety.“
a citation from 2015 Steven Druckers’ book: ”Altered Genes Twisted Truth: How the Venture to Genetically Engineer Our Food Has Subverted Science, Corrupted Government, and Systematically Deceived the Public”
“Most people would be surprised to learn that Bill Clinton, Bill Gates, and
Barack Obama (along with a host of other astute and influential individuals)
were all taken in by the same elaborate fraud.
They’d be even more surprised to learn that it was not perpetrated by a
foreign intelligence agency, an international crime syndicate, or a cabal of
cunning financiers but by a network of distinguished scientists – and that it
did not involve change in the climate but changes to our food.
And, if they’re Americans, they would be shocked to discover that the
US Food and Drug Administration has been a major accomplice – and that
because of its deceptions, for more than fifteen years they and their children
have been regularly ingesting a group of novel products that the agency’s
scientific staff had previously determined to be unduly hazardous to human
health.“https://allianceforbiointegrity.wordpress.com/about-our-lawsuit/
Liguo Zhang et al. “Reverse-transcribed SARS-CoV-2 RNA can integrate into the genome of cultured human cells and can be expressed in patient-derived tissues” Proc Natl Acad Sci U S A. 2021 May 25;118(21):e2105968118.
doi: 10.1073/pnas.2105968118.
https://ptsdlawyers.com/anthrax-vaccine-presents-long-term-effects/
“Cell strain for knocking out human SLC25A12 gene and application thereof“ https://patents.google.com/patent/CN114438087A/en
most of this was beyond my comprehension... what i did understand i didn’t like... don’t want anyone messing with my software... don’t wish to be transformed into some mad scientist designer chimera/ transhuman or to be remotely manipulated for any reason... am bewildered that the public is not furious about the deceptions and personal damages.
Everything old is new again.
The tower of Babel has been resurrected - but now the language is synthetic DNA/RNA as the geneticists play God.
I don't think God will tolerate this rebellion for very long.