About LYING, CRIMES and GcMAF

First updates, the main post is behind the divider bar. THANK YOU for visiting and reading:)

Update 11/10/2022: Ty and Charlene with many others give an amazing summary of everything what can help to stay healthy, including Zach Vorhies (google ‘fan’) who talks about GcMAF: https://go2.propaganda-exposed.com/docuseries/episode-2/

Update 10/11/2022: An OLD interview which needs a refresher right now, due to the astronomical damages which the covid gene modifying injections cause! Liver regeneration within a MONTH with Alpha-Lipoic-Acid and FDA crimes committed in regard to Dr. Burt Berkson:

https://www.brighteon.com/c3238b5a-e086-4517-bcb9-7f78c6d09be8

https://www.brighteon.com/c3238b5a-e086-4517-bcb9-7f78c6d09be8

A check in Oct 2024 of those 2 above links leads to sudden UNAVAILBALE entries on brigtheon… How about the docu series at (available only for few days to watch for free):

https://stopfattyliver.com/1-SLF/ ???

---

Peter’s Stew interview today at:

https://rumble.com/vx51p9-live-ukraines-secret-pentagon-bioweapon-labs-exposed-trump-hhs-alexander-sa.html

has many very important interviews, in which the one with Bishop Mark Grenon is very tragic. To end up in prison, initiated by FDA, for telling the truth about another covid cure: minerals, is almost as if not FDA but CIA was involved! These stories happen all the time, again and again. When people die of Remdesivir, a synthetic patented expensive nuclotide analog, in countless hospitals, damaging kidneys (which produce the most precious natural detox substance of a golden color), that’s not a crime?? But taking some minerals is? What happened to Royal Rife? Or to William D. Kelley who cured countless cancers, including his own stage 4 panceratic cancer, using DIGESTIVE ENZYMES, the very same produced by the diseases tissues? What happened to Dr. Nick Gonzales who continued that strategy? And what happened to Dr. James Jeffrey Bradstreet after he cured his own son from autism while using many therapies including GcMAF? FDA raided his clinic, seizing all patients reports, including GcMAF samples, and then later 2 shots in his back with subsequent ‘suicide’ reports… So many others went down, in a fight for human health freedom. The cures are countless, almost always with non-patented God given nature, including something so simple as B17:

https://principia-scientific.com/vitamin-b17-the-greatest-cover-up-in-the-history-of-cancer/

Lot of the shocking revelations about medical establishment involved in covering up the natural cures can be found in Ty Bollingers’ documentary:” The Truth About Cancer”. Exactly the same happened with ‘covid’ alternative treatments. When you search for GcMAF and SARS-CoV-2 you’ll get amazing reports:

1. ‘Potential role of GcMAF in suppressing the severity of COVID-19-induced immune responses: Lesson learned from HIV’. L Spandera & M. Spandera, Med Hypotheses. 2020 Nov; 144: 110293.

2. Efficacy and Safety of Oral Immunotherapy With GcMAF in Hospitalized Patients With COVID-19 Pneumonia (COral-MAF1) clinical trials!

3. https://www.saisei-mirai.or.jp/chp/imgs/COVID19-summary.pdf

4. https://www.sciencedirect.com/science/article/pii/S2468294222000284 “Immunotherapy with GcMAF revisited - A critical overview of the research of Nobuto Yamamoto“ Cancer Treatment and Research Communications

   Volume 31, 2022, 100537

5. Effects of Vitamin D3-Binding Protein-Derived Macrophage Activating Factor (GcMAF) on Angiogenesis. JNCI: Journal of the National Cancer Institute, Volume 94, Issue 17, 4 September 2002, Pages 1311–1319

Gc protein stands for ‘Vitamin D3 binding protein’, and MAF for macrophage activating factor. It is essential for protection, for activated macrophages of your immune system, but what it needs is Vit D3! Boy, Vit D3 is not patented yet, so get it, es much as you can. The GCMAF is already patented, unfortunately… Every clinical trial is related to patented drugs.. Just in case of GcMAF, the nature always needs to be modified, in order to get it patented, so for GcMAF, here it goes:

https://patentimages.storage.googleapis.com/bd/d8/b4/5d9edf43c09ddd/EP0837932B1.pdf

What J.J. Bradstreet discovered in his GcMAF studies, is described pretty good at:

https://truthviewer.wordpress.com/2017/05/07/nagalase-the-cause-of-autism/

and that is, that Nagalase can be detected only in the vaccinated children, but not otherwise. One citation from the above link: “ Nagalese blocks the GC protein from attaching itself to vitamin D, thus preventing the immune system from doing its job and therefore causing cancer and other serious diseases. Without an active immune system, cancer and viral infections can spread rapidly.”

That’s why sun is so important, that’s why our skin is so important, to produce that wonder in human body, without your knowledge! And what is nagalase? Here a nice review on it:

https://pubmed.ncbi.nlm.nih.gov/29332325/

titled: “Is α-N-acetylgalactosaminidase the key to curing cancer? A mini-review and hypothesis“ by E. Saburi et al., J BUON. Nov-Dec 2017;22(6):1372-1377.

And is the nagalase otherwise known as ‘Alpha-N-acetylgalactosaminidase‘ in the sequence of the SARS-CoV-2 Spike protein, which has lot to do with human blood? Nagalase degrades the blood type A, contributes to cancers, lupus, ASD’s, its pathogenic significance was found in the envelope glycoprotein gp160 of human immunodeficiency virus Type 1, the very same protein whose many fragments are equally contained in the Spike.

Running default BLAST search on similarities between Spike (ncbi code YP_009724390.1) and nagalase, for example Endo-alpha-N-acetylgalactosaminidase from Streptococcus pneumoniae (https://www.uniprot.org/uniprotkb/Q8DR60/entry), you will get: “No significant similarity found.” Changed default search parameters lead to ~35% of identities among 60% of sequence coverage. Just few examples of the NIH BLAST output at: https://blast.ncbi.nlm.nih.gov/Blast.cgi with QUery line representing the amino acids from the Nagalase, the Sbjct line the SRAS-CoV-2 SPike2020 sequence, the line inbetween shows the identical overlaps between the two

20.0 bits(40) 2.0 11/33(33%) 15/33(45%) 3/33(9%)

Query  1582  PDNNKPKDIDFGKTIKAKKIVLTGT---KTYGD  1611 Nagalase
             PD +KP    F + +   K+ L+ +   K YGD      <<Identities
Sbjct  807   PDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGD  839 <<Spike2020
Query  620  SQAQNPFLMTLDG  632
            SQ   PFLM L+G
Sbjct  172  SQ---PFLMDLEG  181
Query  1379  TW-VGIYSTGNASN---TR  1393
             TW V  YSTG  SN   TR
Sbjct  632   TWRV--YSTG--SNVFQTR  646
Query  1420  LTGK-MLTE-NALKNYLP  1435
             LTG   LTE N  K +LP
Sbjct  546   LTGTGVLTESN--KKFLP  561
Query  265  LFDTVTLPAA  274
            LF+ VTL  A
Sbjct  822  LFNKVTLADA  831
Query  1234  FENVAQGIFPF  1244
             FE V Q   PF
Sbjct  168   FEYVSQ---PF  175
Query  477  HVSGDDHIDVTN----------PMKDLAKGYMYGFVSTDK  506
            HVSG      TN          P  D   G  Y F ST+K
Sbjct  69   HVSG------TNGTKRFDNPVLPFND---G-VY-FASTEK  97
uery  1614  DKYQSAAELIF---TRPQVAETPLDL---SGYEAALAKAQKLTDKDNQEEVA  1659
             DKY       F   T P V     DL   SG  A     QK  D  N  EVA
Sbjct  1153  DKY-------FKNHTSPDV-----DLGDISGINASVVNIQKEIDRLN--EVA  1190

and so many more. With sequence lengths of more than 10 amino acids the common sections will possibly have analog antibodies profile.

Run the search without any ‘autoadjustments’, results in smaller sections and much larger amount of overlaps resulting int 75% sequence coverage and 71.4% identities, for example for the human nagalase just few examples:

Query  359  NFTGSVI  365 
            +FTG VI
Sbjct  428  DFTGCVI  434
Query  132  GTTLD  136
            GTTLD
Sbjct  107  GTTLD  111
Query  274  TVLAAPLLMSTD  285
            TVL  PLL  TD
Sbjct  859  TVLP-PLL--TD  867

For whatever reason the search never tries important fragments like this one, having the homology with the HIV gp160 protein:
 
GYDKDG-WFWEYKSPTTSTWYRGSR <<<Streptococcal Nagalase Q8DR60
 Y+    W W Y       W
KYEQYIKWPW-YI------WLGFIA <<<Spike2020

It loks as if the original known human nagalase was cut down into pieces and pasted to ~70% into the Spike amino acid sequence! 
And now check how much GcMAF is inside the Spike? Equally huge amount of different fragments. So on one side, the Spike sequence introduces lot of pieces of nagalase, not frequently found in human bodies, but found in all viruses and on the other hand introduces pieces from extremely important human proteins, needed in human bodies. The reprogramming of every cell to now produce Spike, will end up with limited resources for GcMAF production. What a double swort to kill as much as possible. 

---

How the SYNTHETIC biology, chemical industry tries to invade the nature, our human bodies with lies and deception is very well presented in this summary:

https://www.brighteon.com/daea5da8-33b1-4aa6-aae8-21c58677893e

“Codex Alimentarius” by Dr. Rima Laibow

also from somewhat different point of view:

https://www.bitchute.com/video/07qW2TGmsgQ1/

Codex Alimentarius: Big Pharma and the United Nations Exposed (Documentary) January 15, 2009

The newest report on the covid injections killing from Ed Dowd:
   https://forbiddenknowledgetv.net/edward-dowd-on-future-recession-shocking-findings-in-the-cdc-covid-data-and-democide/